BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00280 (730 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. 26 1.4 AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. 25 1.8 AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. 24 4.2 AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containi... 24 4.2 AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant r... 23 9.7 >DQ655702-1|ABG45862.1| 889|Anopheles gambiae Jxc1 protein. Length = 889 Score = 25.8 bits (54), Expect = 1.4 Identities = 11/31 (35%), Positives = 18/31 (58%) Frame = -1 Query: 241 TTGSESRPAEKIRPETRRADAWVRLQVEQNN 149 T GS+ + AE+ P + R + W L VE ++ Sbjct: 715 TVGSQGKEAERDAPTSSRNEPWNDLPVETSS 745 >AY753542-1|AAV28545.1| 3361|Anopheles gambiae SGS5 protein. Length = 3361 Score = 25.4 bits (53), Expect = 1.8 Identities = 14/37 (37%), Positives = 18/37 (48%) Frame = +3 Query: 351 VLVKLERPQGHQ*YFNHKKGLYANRAYYWRMGSSTHL 461 V V +E +G + K G Y NR WR GS+ L Sbjct: 1840 VRVTIENAKGKKVAKYSKVGSYENRLSTWRYGSNDKL 1876 >AJ304411-1|CAC39104.1| 187|Anopheles gambiae LDL receptor protein. Length = 187 Score = 24.2 bits (50), Expect = 4.2 Identities = 8/27 (29%), Positives = 18/27 (66%) Frame = -3 Query: 482 RVEEVYSKMSTTAHSPVVGSVGIKAFF 402 R++++YS+ T+ V+ S+G K ++ Sbjct: 110 RIKQIYSESMTSVDGLVIDSIGRKLYW 136 >AF291654-1|AAG00600.1| 1340|Anopheles gambiae thioester-containing protein I protein. Length = 1340 Score = 24.2 bits (50), Expect = 4.2 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +1 Query: 448 VVLILEYTSSTLVAETILTNWRYKY 522 V I +YT+ T+V ++ +T +RY Y Sbjct: 304 VSFIEQYTNRTVVKQSQITVYRYAY 328 >AF364132-2|AAL35509.1| 411|Anopheles gambiae putative odorant receptor Or3 protein. Length = 411 Score = 23.0 bits (47), Expect = 9.7 Identities = 10/34 (29%), Positives = 16/34 (47%) Frame = -3 Query: 662 KVFCKCSFYVLIEL*FVLQWKFYLSRTPARNITK 561 K++C C F + F+ W Y + RN T+ Sbjct: 146 KIYCCCHFSMATFFWFMPVWTTYSAYFAVRNSTE 179 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 685,553 Number of Sequences: 2352 Number of extensions: 12315 Number of successful extensions: 18 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 18 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 18 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 74428737 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -