BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00279 (731 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value Z71265-3|CAA95835.2| 403|Caenorhabditis elegans Hypothetical pr... 29 4.5 AC006683-1|AAK71395.4| 954|Caenorhabditis elegans Adenylyl cycl... 29 4.5 >Z71265-3|CAA95835.2| 403|Caenorhabditis elegans Hypothetical protein M05B5.3 protein. Length = 403 Score = 28.7 bits (61), Expect = 4.5 Identities = 10/31 (32%), Positives = 19/31 (61%) Frame = +2 Query: 74 DHIYEKNTGDIIFMHINSIPNVFRNCTLLMR 166 +H+ EKN+ ++I +N +PN C+ + R Sbjct: 35 NHVIEKNSKEVIVRQVNEVPNDEVGCSPIPR 65 >AC006683-1|AAK71395.4| 954|Caenorhabditis elegans Adenylyl cyclase protein 4 protein. Length = 954 Score = 28.7 bits (61), Expect = 4.5 Identities = 13/48 (27%), Positives = 26/48 (54%) Frame = +3 Query: 192 VSSVLNCVIVHKCNRVGI*LHTEIKVQIVHYCLFSDYSVLKYGYFNMI 335 ++S+++CVI+ C T ++ + + +FS YS+L + MI Sbjct: 114 IASIISCVIISAC--------TSMRTSVTYLLIFSTYSLLPMSFMLMI 153 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 15,251,323 Number of Sequences: 27780 Number of extensions: 309607 Number of successful extensions: 615 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 602 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 615 length of database: 12,740,198 effective HSP length: 80 effective length of database: 10,517,798 effective search space used: 1714401074 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -