BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00276 (502 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 44 3e-06 AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. 25 1.4 AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylch... 23 4.4 AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR ... 23 4.4 AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. 23 4.4 AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. 23 4.4 AF203333-1|AAF19828.1| 119|Anopheles gambiae immune-responsive ... 23 4.4 DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormo... 23 5.8 AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. 23 5.8 AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled ... 23 5.8 AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding pr... 23 5.8 M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles ... 23 7.7 AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucl... 23 7.7 AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease pr... 23 7.7 AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deo... 23 7.7 AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. 23 7.7 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 44.0 bits (99), Expect = 3e-06 Identities = 28/86 (32%), Positives = 43/86 (50%), Gaps = 7/86 (8%) Frame = +1 Query: 256 IQGRDVIAQAQSGTGKTATFSISIL-------QQIDTSIRECQALILAPTRELAQQIQKV 414 + GRD++A AQ+G+GKTA F + ++ ++ R +I+APTRELA QI Sbjct: 209 LNGRDLMACAQTGSGKTAAFMLPMIHHLLDKEDSLELRTRNPYIVIVAPTRELAIQIHDE 268 Query: 415 VIALGDHLNAKCHACIGGTNVREDIR 492 K GGT V+ ++ Sbjct: 269 GRKFAHGTKLKVCVSYGGTAVQHQLQ 294 Score = 28.7 bits (61), Expect = 0.12 Identities = 12/33 (36%), Positives = 21/33 (63%) Frame = +2 Query: 149 VETFDDMNLKEELLRGIYAYGFEKPSAIQQRAI 247 VE+F+ L+EE++ + + KP+ IQ+ AI Sbjct: 173 VESFERSGLREEVMTNVRKSSYTKPTPIQRYAI 205 >AY344837-1|AAR05808.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 25.0 bits (52), Expect = 1.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 23 SSERRSEDWPEDSKNGPSKDQGSY 94 ++++ + D SKNGPS Q S+ Sbjct: 95 ANDQTARDGSSSSKNGPSNSQASF 118 >AY705405-1|AAU12514.1| 519|Anopheles gambiae nicotinic acetylcholine receptor subunitbeta 1 protein. Length = 519 Score = 23.4 bits (48), Expect = 4.4 Identities = 10/25 (40%), Positives = 17/25 (68%) Frame = +2 Query: 287 SQELEKLLLSLYRFYNKSIQAFVNV 361 S++ E+L+ L+R YNK I+ N+ Sbjct: 24 SEDEERLVRDLFRGYNKLIRPVQNM 48 >AY347946-1|AAR28374.1| 640|Anopheles gambiae putative NPY GPCR protein. Length = 640 Score = 23.4 bits (48), Expect = 4.4 Identities = 11/30 (36%), Positives = 13/30 (43%) Frame = -1 Query: 424 ELSPPSEFVGPALLWEPGSKLDIHECLYRF 335 E SP S F G W+ G CL+ F Sbjct: 394 ENSPKSAFTGRIEFWDGGRDFCFLICLFSF 423 >AY344838-1|AAR05809.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 4.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 23 SSERRSEDWPEDSKNGPSKDQGSY 94 ++++ + D SKNGPS Q S+ Sbjct: 95 ANDQTARDGSASSKNGPSNSQVSF 118 >AY344836-1|AAR05807.1| 221|Anopheles gambiae TEP4 protein. Length = 221 Score = 23.4 bits (48), Expect = 4.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 23 SSERRSEDWPEDSKNGPSKDQGSY 94 ++++ + D SKNGPS Q S+ Sbjct: 95 ANDQTARDGSASSKNGPSNSQVSF 118 >AF203333-1|AAF19828.1| 119|Anopheles gambiae immune-responsive alpha-macroglobulinand complement C3-related protein IMCR14 protein. Length = 119 Score = 23.4 bits (48), Expect = 4.4 Identities = 9/24 (37%), Positives = 15/24 (62%) Frame = +2 Query: 23 SSERRSEDWPEDSKNGPSKDQGSY 94 ++++ + D SKNGPS Q S+ Sbjct: 24 ANDQTARDGSASSKNGPSNSQVSF 47 >DQ396551-1|ABD60146.1| 354|Anopheles gambiae adipokinetic hormone receptor protein. Length = 354 Score = 23.0 bits (47), Expect = 5.8 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = -1 Query: 235 LDCR--RFFKTIGVYASQQFFFEVHVIEGFDNLIPVGVKCPRVHSRRSIVTTLILRWPIF 62 L CR FF+T G+Y S + V F L P+ +VH R+++ + W + Sbjct: 119 LMCRVMAFFRTFGLYLSSFILICISVDRYFAVLKPL-----KVHEHRAVL-MIAAAWIMS 172 Query: 61 GI 56 G+ Sbjct: 173 GL 174 >AY994095-1|AAX86008.1| 144|Anopheles gambiae unknown protein. Length = 144 Score = 23.0 bits (47), Expect = 5.8 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 71 PSKDQGSYDGPPGMDPGTLDTDWDQV 148 P+ G Y PP M PG +D+D Q+ Sbjct: 7 PTSVHGPY--PPHMVPGGVDSDGAQI 30 >AY298745-1|AAQ63187.1| 354|Anopheles gambiae G-protein coupled receptor protein. Length = 354 Score = 23.0 bits (47), Expect = 5.8 Identities = 18/62 (29%), Positives = 29/62 (46%), Gaps = 2/62 (3%) Frame = -1 Query: 235 LDCR--RFFKTIGVYASQQFFFEVHVIEGFDNLIPVGVKCPRVHSRRSIVTTLILRWPIF 62 L CR FF+T G+Y S + V F L P+ +VH R+++ + W + Sbjct: 119 LMCRVMAFFRTFGLYLSSFILICISVDRYFAVLKPL-----KVHEHRAVL-MIAAAWIMS 172 Query: 61 GI 56 G+ Sbjct: 173 GL 174 >AY146717-1|AAO12077.1| 188|Anopheles gambiae odorant-binding protein AgamOBP14 protein. Length = 188 Score = 23.0 bits (47), Expect = 5.8 Identities = 11/27 (40%), Positives = 15/27 (55%) Frame = -3 Query: 83 DPSMAHFWNPLANLLTFFQTNKTCFNR 3 DP A +++ L F QT TCFN+ Sbjct: 36 DPVPATSTFIVSDFLQFLQTAVTCFNK 62 >M93691-1|AAA29366.1| 574|Anopheles gambiae protein ( Anopheles gambiae RT2 retroposon. ). Length = 574 Score = 22.6 bits (46), Expect = 7.7 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +2 Query: 215 EKPSAIQQRAIMPSSKDAMLSLK 283 E+P A RA+MP +A+ +++ Sbjct: 231 EQPRASTSRAVMPPRSEALTAVR 253 >AJ439060-5|CAD27756.1| 245|Anopheles gambiae putative deoxynucleoside kinase protein. Length = 245 Score = 22.6 bits (46), Expect = 7.7 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +3 Query: 270 CYRSSPVRNWKNC 308 C + PV W+NC Sbjct: 43 CLLTEPVEKWRNC 55 >AJ276486-1|CAB90818.1| 364|Anopheles gambiae serine protease protein. Length = 364 Score = 22.6 bits (46), Expect = 7.7 Identities = 16/50 (32%), Positives = 25/50 (50%), Gaps = 1/50 (2%) Frame = -3 Query: 338 ICCRIDIEKVAVFPVPDWA*AITSRPWMKALLRVAGLQKVFQNH-RRICL 192 + CR D ++ P P++ SRP +LR+A F ++ R ICL Sbjct: 185 VICREDYAVESIVPHPEYDMHNISRPNDICILRLAS-DVTFNDYVRPICL 233 >AF488801-1|AAO49462.1| 246|Anopheles gambiae multisubstrate deoxyribonucleoside kinaseprotein. Length = 246 Score = 22.6 bits (46), Expect = 7.7 Identities = 6/13 (46%), Positives = 8/13 (61%) Frame = +3 Query: 270 CYRSSPVRNWKNC 308 C + PV W+NC Sbjct: 43 CLLTEPVEKWRNC 55 >AF063021-4|AAC16248.1| 93|Anopheles gambiae unknown protein. Length = 93 Score = 22.6 bits (46), Expect = 7.7 Identities = 9/20 (45%), Positives = 11/20 (55%) Frame = -1 Query: 127 KCPRVHSRRSIVTTLILRWP 68 +C R R I+TT RWP Sbjct: 8 RCARASPSRPILTTRGRRWP 27 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 574,352 Number of Sequences: 2352 Number of extensions: 12199 Number of successful extensions: 30 Number of sequences better than 10.0: 16 Number of HSP's better than 10.0 without gapping: 28 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 29 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 44823054 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -