BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00274 (748 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_33442| Best HMM Match : AAA (HMM E-Value=0) 151 8e-37 SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) 84 1e-16 SB_9909| Best HMM Match : AAA (HMM E-Value=0) 74 1e-13 SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) 66 2e-11 SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) 58 1e-08 SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 5e-07 SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 9e-07 SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 8e-05 SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 5e-04 SB_19460| Best HMM Match : AAA (HMM E-Value=0) 42 5e-04 SB_45627| Best HMM Match : AAA (HMM E-Value=0) 41 0.001 SB_28977| Best HMM Match : AAA (HMM E-Value=0) 38 0.007 SB_48561| Best HMM Match : AAA (HMM E-Value=0) 36 0.026 SB_32179| Best HMM Match : DUF1409 (HMM E-Value=0.071) 31 0.99 SB_11522| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.3 SB_55825| Best HMM Match : Arch_fla_DE (HMM E-Value=2.9) 29 3.0 SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_8000| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.0 SB_31987| Best HMM Match : Troponin (HMM E-Value=7.1) 29 4.0 SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) 29 4.0 SB_36447| Best HMM Match : Trp_repressor (HMM E-Value=2.5) 29 5.3 SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) 28 7.0 SB_50799| Best HMM Match : I-set (HMM E-Value=0) 28 7.0 SB_29470| Best HMM Match : Glyco_transf_10 (HMM E-Value=9.1e-39) 28 9.2 SB_7001| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 9.2 >SB_33442| Best HMM Match : AAA (HMM E-Value=0) Length = 369 Score = 151 bits (365), Expect = 8e-37 Identities = 74/83 (89%), Positives = 79/83 (95%) Frame = +3 Query: 249 FITKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQN 428 +IT YKKL++ LEFLEVQEEYIKDEQ+NLKKE LHAQEEVKRIQSVPLVIGQFLEAVDQN Sbjct: 40 YIT-YKKLEKQLEFLEVQEEYIKDEQKNLKKELLHAQEEVKRIQSVPLVIGQFLEAVDQN 98 Query: 429 TGIVGSTTGSNYYVRILSTIDRE 497 TGIV STTGSNYYVRILSTID+E Sbjct: 99 TGIVASTTGSNYYVRILSTIDKE 121 Score = 134 bits (323), Expect = 9e-32 Identities = 61/78 (78%), Positives = 72/78 (92%) Frame = +2 Query: 497 IVEASASVALHKHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVE 676 +++ SASVALHKHSNALVD+LPPEADSSI+ML +EKP+V Y++IGGMD QKQEIREAVE Sbjct: 122 LLKPSASVALHKHSNALVDILPPEADSSIAMLTNEEKPNVSYAEIGGMDIQKQEIREAVE 181 Query: 677 LPLTHVELYRQIGIEPPR 730 LPLTH ELY+QIGI+PPR Sbjct: 182 LPLTHFELYKQIGIDPPR 199 >SB_33584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 455 Score = 84.2 bits (199), Expect = 1e-16 Identities = 36/78 (46%), Positives = 58/78 (74%) Frame = +2 Query: 497 IVEASASVALHKHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVE 676 ++E +V L+ +A+V VL +AD +++++ ++ P Y+DIGG+DTQ QEI+E+VE Sbjct: 338 LLEPGCTVLLNHKVHAVVGVLSDDADPMVTVMKLEKAPQESYADIGGLDTQIQEIKESVE 397 Query: 677 LPLTHVELYRQIGIEPPR 730 LPLTH ELY ++GI+PP+ Sbjct: 398 LPLTHPELYEEMGIKPPK 415 Score = 61.3 bits (142), Expect = 8e-10 Identities = 29/82 (35%), Positives = 52/82 (63%), Gaps = 2/82 (2%) Frame = +3 Query: 258 KYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQE--EVKRIQSVPLVIGQFLEAVDQNT 431 K KL R+ +FL ++EE+I++++R +E H +E +V ++ P+ +G E +D N Sbjct: 256 KLLKLDRIKDFLLMEEEFIQNQERLKPQEEKHEEERSKVDDLRGTPMSVGNLEEIIDDNH 315 Query: 432 GIVGSTTGSNYYVRILSTIDRE 497 IV ++ GS +YV ILS +D++ Sbjct: 316 AIVSTSVGSEHYVSILSFVDKD 337 >SB_9909| Best HMM Match : AAA (HMM E-Value=0) Length = 400 Score = 73.7 bits (173), Expect = 1e-13 Identities = 31/58 (53%), Positives = 42/58 (72%) Frame = +2 Query: 557 LPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPR 730 LPP+ D +++M+Q +EKPDV YSDIGG Q ++RE VE PL H E + +GIEPP+ Sbjct: 62 LPPKIDPTVTMMQVEEKPDVTYSDIGGCKEQIDKLREVVETPLLHPERFVNLGIEPPK 119 >SB_35973| Best HMM Match : zf-CCHC (HMM E-Value=0.0026) Length = 779 Score = 66.5 bits (155), Expect = 2e-11 Identities = 28/73 (38%), Positives = 48/73 (65%) Frame = +2 Query: 518 VALHKHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVE 697 VAL + ++ LP E D + + ++ ++ YSD+GG+ Q +E+RE +ELPLT+ E Sbjct: 100 VALDMTTLTIMRYLPREVDPLVYNMSHEDPGNISYSDVGGLSEQIRELREVIELPLTNPE 159 Query: 698 LYRQIGIEPPRVC 736 L++++GI PP+ C Sbjct: 160 LFQRVGIAPPKGC 172 Score = 41.9 bits (94), Expect = 5e-04 Identities = 20/81 (24%), Positives = 45/81 (55%) Frame = +3 Query: 252 ITKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNT 431 + +YKK L+ + + ++++ ++ KEY ++ ++K +QSV ++G+ L+ + + Sbjct: 11 LLEYKKKLLEHRELDARLKEMREQLKDFTKEYDKSENDLKALQSVGQIVGEVLKQLTEEK 70 Query: 432 GIVGSTTGSNYYVRILSTIDR 494 IV +T G Y V +D+ Sbjct: 71 FIVKATNGPRYVVGCRRQVDK 91 >SB_3919| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 442 Score = 57.6 bits (133), Expect = 1e-08 Identities = 22/55 (40%), Positives = 37/55 (67%) Frame = +2 Query: 566 EADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPR 730 E D +S++ ++ PD Y +GG+D Q +EI+E +ELP+ H EL+ +GI+ P+ Sbjct: 158 EVDPLVSLMMVEKVPDSTYEMVGGLDKQIKEIKEVIELPVKHPELFEALGIDQPK 212 >SB_14682| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 802 Score = 52.0 bits (119), Expect = 5e-07 Identities = 21/43 (48%), Positives = 32/43 (74%) Frame = +2 Query: 602 EKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPR 730 E P V +SD+GG + K++++EAVE PL H E ++++GI PPR Sbjct: 530 EVPKVHWSDVGGNEMIKRKLKEAVEWPLKHPEAFQRLGIRPPR 572 Score = 50.4 bits (115), Expect = 2e-06 Identities = 21/51 (41%), Positives = 32/51 (62%) Frame = +2 Query: 578 SISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPR 730 S+ ++ K V + IGG+ TQ Q +RE +E+PLT+ EL+ G+ PPR Sbjct: 241 SVIKKDSEAKKGVSFQSIGGLKTQIQAVREMIEMPLTNPELFTAYGVPPPR 291 >SB_5903| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 51.2 bits (117), Expect = 9e-07 Identities = 22/48 (45%), Positives = 33/48 (68%) Frame = +2 Query: 518 VALHKHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEI 661 V ++K S +++ LP E DS + ++ DE+P QYSDIGG+D Q QE+ Sbjct: 119 VGVNKDSYLILEKLPAEYDSRVKAMEVDERPTEQYSDIGGLDQQIQEM 166 >SB_40956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1086 Score = 44.8 bits (101), Expect = 8e-05 Identities = 17/43 (39%), Positives = 29/43 (67%) Frame = +2 Query: 575 SSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELY 703 S + A + PD+ + D+GG+D+ K+EI + ++LPL H EL+ Sbjct: 796 SHADAIGAPKIPDISWKDVGGLDSVKEEILDTIQLPLLHPELF 838 >SB_37200| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 908 Score = 41.9 bits (94), Expect = 5e-04 Identities = 15/38 (39%), Positives = 27/38 (71%) Frame = +2 Query: 617 QYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPR 730 ++ D+GG++ KQ +R+A+E PL H E + ++G+ PR Sbjct: 482 RWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPR 519 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/65 (24%), Positives = 33/65 (50%) Frame = +2 Query: 536 SNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIG 715 +NA V V+ + + +I ++ D + G+D + ++E V+ PL + E + +G Sbjct: 183 NNAYV-VITEKTNINIESVKVGSSVDSGNIILSGLDDSIKMLKELVQFPLYYPESFSHLG 241 Query: 716 IEPPR 730 I P+ Sbjct: 242 INGPK 246 >SB_19460| Best HMM Match : AAA (HMM E-Value=0) Length = 340 Score = 41.9 bits (94), Expect = 5e-04 Identities = 15/38 (39%), Positives = 27/38 (71%) Frame = +2 Query: 617 QYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPR 730 ++ D+GG++ KQ +R+A+E PL H E + ++G+ PR Sbjct: 11 RWDDVGGLEGVKQALRQAIEWPLLHPEAFARMGLRRPR 48 >SB_45627| Best HMM Match : AAA (HMM E-Value=0) Length = 628 Score = 40.7 bits (91), Expect = 0.001 Identities = 15/43 (34%), Positives = 29/43 (67%) Frame = +2 Query: 602 EKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPR 730 E P+V + DIGG++ K+E++E V+ P+ H + + + G+ P + Sbjct: 303 EVPNVSWDDIGGLEGVKRELQELVQYPVEHPDKFLKFGMTPSK 345 >SB_28977| Best HMM Match : AAA (HMM E-Value=0) Length = 442 Score = 38.3 bits (85), Expect = 0.007 Identities = 15/34 (44%), Positives = 26/34 (76%) Frame = +2 Query: 602 EKPDVQYSDIGGMDTQKQEIREAVELPLTHVELY 703 EKP+V++SDI G+++ K+ ++EAV LP+ L+ Sbjct: 90 EKPNVKWSDIAGLESAKEALKEAVILPIKFPHLF 123 >SB_48561| Best HMM Match : AAA (HMM E-Value=0) Length = 2021 Score = 36.3 bits (80), Expect = 0.026 Identities = 15/52 (28%), Positives = 30/52 (57%) Frame = +2 Query: 575 SSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIGIEPPR 730 + + + D K V++ +GG++ Q Q ++E + PL + E++ + I PPR Sbjct: 870 ADVDPMSVDRK--VKFDSVGGLNKQIQALKEMILFPLVYPEVFDKFKITPPR 919 >SB_32179| Best HMM Match : DUF1409 (HMM E-Value=0.071) Length = 429 Score = 31.1 bits (67), Expect = 0.99 Identities = 15/45 (33%), Positives = 27/45 (60%) Frame = +3 Query: 258 KYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPL 392 +Y+ Q ++F +V+EE K +Q N+K A+EE +R +S + Sbjct: 148 EYENKQLRMDFEKVEEEVEKWKQNNMKLTATRAREEQQRAKSTAM 192 >SB_11522| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 277 Score = 30.7 bits (66), Expect = 1.3 Identities = 12/26 (46%), Positives = 19/26 (73%) Frame = +2 Query: 608 PDVQYSDIGGMDTQKQEIREAVELPL 685 PDV++ DI G+D K+ ++EAV P+ Sbjct: 52 PDVRWDDIIGLDAAKRLVKEAVVYPI 77 >SB_55825| Best HMM Match : Arch_fla_DE (HMM E-Value=2.9) Length = 208 Score = 29.5 bits (63), Expect = 3.0 Identities = 14/58 (24%), Positives = 32/58 (55%) Frame = +3 Query: 270 LQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIVG 443 +Q + E ++ E+ + + + KE+ + V+ + V+GQ +++VD+ G+VG Sbjct: 2 VQSIDEKVQDAEQKVTKGFQEVGKEFQVVGQHVQSVDEKVGVVGQHVQSVDEKVGVVG 59 >SB_30385| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 29.5 bits (63), Expect = 3.0 Identities = 16/65 (24%), Positives = 33/65 (50%) Frame = +2 Query: 536 SNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMDTQKQEIREAVELPLTHVELYRQIG 715 +NA V V+ + + +I ++ D + G+D + ++E V+ PL + E + +G Sbjct: 13 NNAYV-VITEKTNINIESVKVGSSVDSGNIILSGLDDSIKMLKELVQFPLYYPESFSHLG 71 Query: 716 IEPPR 730 I P+ Sbjct: 72 INGPK 76 >SB_8000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 29.5 bits (63), Expect = 3.0 Identities = 17/64 (26%), Positives = 34/64 (53%), Gaps = 2/64 (3%) Frame = +3 Query: 264 KKLQRMLEFLEVQEEYIKDEQRNLKKEYLH--AQEEVKRIQSVPLVIGQFLEAVDQNTGI 437 KK+ +LE + + + I +E + +KK H + K++ + +E+V++N G+ Sbjct: 188 KKMAEILEEIGISPDRIHEESQQIKKPSFHDCTNKPAKKMTPRSVSSPSMMESVNEN-GL 246 Query: 438 VGST 449 GST Sbjct: 247 PGST 250 >SB_31987| Best HMM Match : Troponin (HMM E-Value=7.1) Length = 235 Score = 29.1 bits (62), Expect = 4.0 Identities = 16/42 (38%), Positives = 24/42 (57%) Frame = +3 Query: 315 KDEQRNLKKEYLHAQEEVKRIQSVPLVIGQFLEAVDQNTGIV 440 +DE+R+ KE + +V+R++S V FL QN GIV Sbjct: 41 QDEERDSVKEKNRQRSDVERLRSTYHVSESFLAMDKQNEGIV 82 >SB_56523| Best HMM Match : Pox_A_type_inc (HMM E-Value=0) Length = 2858 Score = 29.1 bits (62), Expect = 4.0 Identities = 13/38 (34%), Positives = 22/38 (57%) Frame = +3 Query: 270 LQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQS 383 ++ LE L+ Q IKDE NLK+ Q+E+ +++ Sbjct: 1357 IEGQLESLKAQMSKIKDENENLKESDARRQQEILDLEN 1394 >SB_36447| Best HMM Match : Trp_repressor (HMM E-Value=2.5) Length = 228 Score = 28.7 bits (61), Expect = 5.3 Identities = 17/74 (22%), Positives = 37/74 (50%) Frame = +2 Query: 464 LCPYSLNN**RIVEASASVALHKHSNALVDVLPPEADSSISMLQADEKPDVQYSDIGGMD 643 L P+ L R ++ S +A H N + ++LPP + I ++A + +V+Y ++ Sbjct: 130 LAPHFLEFLDRRLDKSIVIAYKIHVNTVKEILPPFSQKYIDRMKA-AQGEVKYLEVAKYY 188 Query: 644 TQKQEIREAVELPL 685 + + ++ +PL Sbjct: 189 SSAMDTAVSIGVPL 202 >SB_56522| Best HMM Match : Pox_A_type_inc (HMM E-Value=1.6e-30) Length = 3071 Score = 28.3 bits (60), Expect = 7.0 Identities = 11/46 (23%), Positives = 27/46 (58%) Frame = +3 Query: 246 RFITKYKKLQRMLEFLEVQEEYIKDEQRNLKKEYLHAQEEVKRIQS 383 R + + R L +LE + E ++ E+ LKK++ ++++E +++ Sbjct: 1870 RLQNEISAINRKLVYLETRNENLESEKDRLKKDFANSKKESAELRA 1915 >SB_50799| Best HMM Match : I-set (HMM E-Value=0) Length = 1195 Score = 28.3 bits (60), Expect = 7.0 Identities = 13/33 (39%), Positives = 16/33 (48%) Frame = -3 Query: 209 NAKPFESVTWSSFSGKIIPISSIVSIAKRIRVL 111 N KP VTWS G IP +S+ RV+ Sbjct: 266 NGKPPPRVTWSKVGGASIPFVQSLSVNDNFRVV 298 >SB_29470| Best HMM Match : Glyco_transf_10 (HMM E-Value=9.1e-39) Length = 426 Score = 27.9 bits (59), Expect = 9.2 Identities = 15/37 (40%), Positives = 17/37 (45%) Frame = -1 Query: 430 VF*STASRNCPMTRGTDCMRFTSSCACKYSFFKFRCS 320 VF SR + GT C RFT C +KFR S Sbjct: 260 VFGGCRSRFPKHSEGTSCRRFTKECDNLMRRYKFRLS 296 >SB_7001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 9.2 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -2 Query: 594 CNIEIELSASGGKTSTRALECLCRATEAEASTILYQ 487 CNI+IE GG TS+RA AT E LY+ Sbjct: 22 CNIQIEFLQPGGSTSSRA-----SATAVELQFALYE 52 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,173,266 Number of Sequences: 59808 Number of extensions: 404760 Number of successful extensions: 1227 Number of sequences better than 10.0: 25 Number of HSP's better than 10.0 without gapping: 1106 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1224 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 2022185256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -