BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00270 (727 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 24 1.3 DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like recept... 24 1.7 DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholi... 23 2.2 DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. 21 9.0 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 24.2 bits (50), Expect = 1.3 Identities = 9/30 (30%), Positives = 19/30 (63%) Frame = +3 Query: 573 CFCTMATLPGQWRRTATPDFIQILTISHAL 662 C C+M LPG +T+T ++ +I+ + + + Sbjct: 684 CNCSMDWLPGINNQTSTREYPRIMDLDNVM 713 >DQ869051-1|ABJ09598.1| 581|Apis mellifera pyrokinin-like receptor 2 protein. Length = 581 Score = 23.8 bits (49), Expect = 1.7 Identities = 13/34 (38%), Positives = 16/34 (47%) Frame = +3 Query: 222 LRRPRSLYSTVREV*FEPAEAHRDSGEEPASGQR 323 LRR R L +TV H DSG ++ QR Sbjct: 248 LRRSRMLTATVNRNHLSGGTNHWDSGRRKSAAQR 281 >DQ026037-1|AAY87896.1| 431|Apis mellifera nicotinic acetylcholine receptor alpha9subunit protein. Length = 431 Score = 23.4 bits (48), Expect = 2.2 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = +2 Query: 77 SVSDTPSLKDLPKVATDLKS 136 SVS PS+K + K ATD S Sbjct: 156 SVSCVPSVKHVAKCATDFSS 175 >DQ435334-1|ABD92649.1| 135|Apis mellifera OBP17 protein. Length = 135 Score = 21.4 bits (43), Expect = 9.0 Identities = 7/24 (29%), Positives = 16/24 (66%) Frame = +2 Query: 125 DLKSQLEGFNTSCLRDVDTNEKIV 196 +LKS L + C++++ T ++I+ Sbjct: 21 ELKSGLHTVQSVCMKEIGTAQQII 44 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 200,991 Number of Sequences: 438 Number of extensions: 4726 Number of successful extensions: 6 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -