BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00266 (769 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC16H5.13 |||WD repeat protein |Schizosaccharomyces pombe|chr ... 26 5.2 SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, ... 25 9.0 >SPBC16H5.13 |||WD repeat protein |Schizosaccharomyces pombe|chr 2|||Manual Length = 1026 Score = 26.2 bits (55), Expect = 5.2 Identities = 14/31 (45%), Positives = 18/31 (58%) Frame = -1 Query: 262 TPCITTFTKKSLVALSQSPEDLPSPHFPVPS 170 T CI T + +L+ L QSPE PHF + S Sbjct: 253 TACIFTLSSSTLLKLHQSPE----PHFELIS 279 >SPAC1327.01c ||SPAC1783.09c, SPAC18G6.16c|transcription factor, zf-fungal binuclear cluster type |Schizosaccharomyces pombe|chr 1|||Manual Length = 977 Score = 25.4 bits (53), Expect = 9.0 Identities = 12/23 (52%), Positives = 14/23 (60%) Frame = -1 Query: 406 FACSSQ*QPWRSHWPSLDDHRNW 338 FA +S Q W WPS DD RN+ Sbjct: 932 FAKNSDLQQWNGLWPS-DDLRNY 953 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,977,209 Number of Sequences: 5004 Number of extensions: 60254 Number of successful extensions: 145 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 138 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 145 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 369323696 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -