BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00266 (769 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor... 24 1.4 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 23 2.4 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 23 3.1 AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. 22 7.2 U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodops... 21 9.5 DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex det... 21 9.5 DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex det... 21 9.5 DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex det... 21 9.5 DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex det... 21 9.5 DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex det... 21 9.5 DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex det... 21 9.5 DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex det... 21 9.5 DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex det... 21 9.5 DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex det... 21 9.5 AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex det... 21 9.5 AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex det... 21 9.5 AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex det... 21 9.5 AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex det... 21 9.5 AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodo... 21 9.5 >U15956-1|AAA67444.1| 129|Apis mellifera hymenoptaecin precursor protein. Length = 129 Score = 24.2 bits (50), Expect = 1.4 Identities = 10/26 (38%), Positives = 14/26 (53%) Frame = +1 Query: 274 DRGKLTGQAYGTRVLGPGGDSTSYGG 351 D+ +TG AYG + PG S + G Sbjct: 66 DKNGMTGDAYGGLNIRPGQPSRQHAG 91 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 23.4 bits (48), Expect = 2.4 Identities = 7/15 (46%), Positives = 9/15 (60%) Frame = -1 Query: 379 WRSHWPSLDDHRNWY 335 W +H P+ D NWY Sbjct: 661 WLNHSPNYDQVTNWY 675 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 23.0 bits (47), Expect = 3.1 Identities = 12/53 (22%), Positives = 20/53 (37%) Frame = +1 Query: 448 WDLGKNTHLSAGGWSLRSSVKKA*CRFTGPDYSRVVLPTALSKQLYKCRLDKH 606 W G N S + + CR +GP +V + + + CR + H Sbjct: 690 WLPGINNQTSTREYPRIMDLDNVMCRTSGPRGVAIVSASTARSEQFLCRYEAH 742 >AY569713-1|AAS86666.1| 401|Apis mellifera feminizer protein. Length = 401 Score = 21.8 bits (44), Expect = 7.2 Identities = 11/36 (30%), Positives = 17/36 (47%) Frame = +1 Query: 130 KVSPTPSRYSRLCHLGQGNGGREGLRDFGRERPRTF 237 + S SRY L H + + +G R R+R R + Sbjct: 226 RTSSCHSRYEDLRHEDRNSYRNDGERSCSRDRSREY 261 >U26026-1|AAA69069.1| 377|Apis mellifera long-wavelength rhodopsin protein. Length = 377 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 26 YSKVLLSAAFLVCVNAQVSMPP 91 +++ LLSA++LVC V P Sbjct: 207 FNRGLLSASYLVCYGIWVYFVP 228 >DQ325133-1|ABD14147.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNFFRQNFI 633 NY N+Y ++ K ++ N+I Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYI 116 >DQ325075-1|ABD14089.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNFFRQNFI 633 NY N+Y ++ K ++ N+I Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYI 116 >DQ325074-1|ABD14088.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNFFRQNFI 633 NY N+Y ++ K ++ N+I Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYI 116 >DQ325073-1|ABD14087.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNFFRQNFI 633 NY N+Y ++ K ++ N+I Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYI 116 >DQ325072-1|ABD14086.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNFFRQNFI 633 NY N+Y ++ K ++ N+I Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYI 116 >DQ325071-1|ABD14085.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNFFRQNFI 633 NY N+Y ++ K ++ N+I Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYI 116 >DQ325070-1|ABD14084.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNFFRQNFI 633 NY N+Y ++ K ++ N+I Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYI 116 >DQ325069-1|ABD14083.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNFFRQNFI 633 NY N+Y ++ K ++ N+I Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYI 116 >DQ325068-1|ABD14082.1| 181|Apis mellifera complementary sex determiner protein. Length = 181 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNFFRQNFI 633 NY N+Y ++ K ++ N+I Sbjct: 93 NYNNNYNNYNKHNYNKLYYNINYI 116 >AY569697-1|AAS86650.1| 413|Apis mellifera complementary sex determiner protein. Length = 413 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/18 (38%), Positives = 11/18 (61%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNF 651 NY+ N+Y +YKN+ Sbjct: 328 NYKYNYNNYNKKLYYKNY 345 >AY569696-1|AAS86649.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNFFRQNFI 633 NY N+Y ++ K ++ N+I Sbjct: 326 NYNNNYNNYNKHNYNKLYYNINYI 349 >AY569695-1|AAS86648.1| 414|Apis mellifera complementary sex determiner protein. Length = 414 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/24 (29%), Positives = 13/24 (54%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNFFRQNFI 633 NY N+Y ++ K ++ N+I Sbjct: 326 NYNNNYNNYNKHNYNKLYYNINYI 349 >AY350618-1|AAQ57660.1| 425|Apis mellifera complementary sex determiner protein. Length = 425 Score = 21.4 bits (43), Expect = 9.5 Identities = 7/23 (30%), Positives = 12/23 (52%) Frame = -3 Query: 704 NYRTQINSYKSIDFYKNFFRQNF 636 NY N+Y + + Y N + N+ Sbjct: 326 NYNNYNNNYNNYNNYNNNYNNNY 348 >AF091732-1|AAD02869.2| 154|Apis mellifera long-wavelength rhodopsin protein. Length = 154 Score = 21.4 bits (43), Expect = 9.5 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 26 YSKVLLSAAFLVCVNAQVSMPP 91 +++ LLSA++LVC V P Sbjct: 83 FNRGLLSASYLVCYGIWVYFVP 104 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 207,190 Number of Sequences: 438 Number of extensions: 4249 Number of successful extensions: 25 Number of sequences better than 10.0: 19 Number of HSP's better than 10.0 without gapping: 24 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 25 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24032646 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -