BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00263 (689 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. 23 2.1 DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monoo... 22 6.3 >AY375535-1|AAQ82648.1| 147|Apis mellifera doublesex protein. Length = 147 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/38 (34%), Positives = 19/38 (50%) Frame = +2 Query: 113 VGLESNFSIYIGLGQSVLTLPTSYPRPLAPAPPSKRQV 226 V S+ I+ G G S++T+P + R L P P V Sbjct: 76 VSSHSSNGIHTGFGGSIITIPPT--RKLPPLHPHTAMV 111 >DQ232888-1|ABB36783.1| 499|Apis mellifera cytochrome P450 monooxygenase protein. Length = 499 Score = 21.8 bits (44), Expect = 6.3 Identities = 8/23 (34%), Positives = 15/23 (65%) Frame = +1 Query: 523 IIFIHLYYYCKKT*NSSRYRGLL 591 ++F+ LYYY T + + RG++ Sbjct: 13 VLFLALYYYLTSTFDFWKSRGVV 35 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 191,192 Number of Sequences: 438 Number of extensions: 4148 Number of successful extensions: 3 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 3 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 3 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21073995 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -