BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00262 (643 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC22H10.07 |scd2|ral3|scaffold protein Scd2|Schizosaccharomyce... 27 3.0 SPAC3C7.06c |pit1||serine/threonine protein kinase Pit1|Schizosa... 26 4.0 SPBC4B4.01c |||fumble family pantothenate kinase |Schizosaccharo... 26 5.3 SPAC6G10.05c |||TRAPP complex subunit Trs120 |Schizosaccharomyce... 26 5.3 SPBPB10D8.02c |||arylsulfatase |Schizosaccharomyces pombe|chr 2|... 26 5.3 SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizos... 25 9.3 >SPAC22H10.07 |scd2|ral3|scaffold protein Scd2|Schizosaccharomyces pombe|chr 1|||Manual Length = 536 Score = 26.6 bits (56), Expect = 3.0 Identities = 21/61 (34%), Positives = 27/61 (44%) Frame = -2 Query: 183 QERAVNLSILPVSGPGEISRVESN*AAGSTPGGALPSIPLSFSFATILPPESKIFGFPEA 4 + V L LP+ G VES + P ALP PLSFS P ++ PE+ Sbjct: 398 ENELVKLFFLPLDGD-----VESPHPTSTMPE-ALPREPLSFSLPEKAPEKATNISIPES 451 Query: 3 A 1 A Sbjct: 452 A 452 >SPAC3C7.06c |pit1||serine/threonine protein kinase Pit1|Schizosaccharomyces pombe|chr 1|||Manual Length = 650 Score = 26.2 bits (55), Expect = 4.0 Identities = 14/34 (41%), Positives = 20/34 (58%) Frame = -3 Query: 131 FPVLSQIKPQAPLLVVPFRQFL*VSALQPYSPRS 30 FPVL QI+P P L + R F+ S+ SP++ Sbjct: 441 FPVLPQIRPSTP-LNLKLRNFIISSSEDSTSPKA 473 >SPBC4B4.01c |||fumble family pantothenate kinase |Schizosaccharomyces pombe|chr 2|||Manual Length = 403 Score = 25.8 bits (54), Expect = 5.3 Identities = 14/42 (33%), Positives = 22/42 (52%) Frame = -2 Query: 165 LSILPVSGPGEISRVESN*AAGSTPGGALPSIPLSFSFATIL 40 +SIL V+GP + R+ + G T G L + + SF +L Sbjct: 214 VSILKVTGPSQFERIGGSSLGGGTLWGLLSLLTPANSFDEML 255 >SPAC6G10.05c |||TRAPP complex subunit Trs120 |Schizosaccharomyces pombe|chr 1|||Manual Length = 1210 Score = 25.8 bits (54), Expect = 5.3 Identities = 12/29 (41%), Positives = 17/29 (58%) Frame = -2 Query: 234 DKSLHQLRTAMHHHPPNQERAVNLSILPV 148 D +LH + +H + E A NLSILP+ Sbjct: 1061 DDNLHHGEIYLRNHILSDEMANNLSILPI 1089 >SPBPB10D8.02c |||arylsulfatase |Schizosaccharomyces pombe|chr 2|||Manual Length = 554 Score = 25.8 bits (54), Expect = 5.3 Identities = 12/32 (37%), Positives = 17/32 (53%) Frame = -3 Query: 200 TTTHRIKKELLICQSFRCPGLVRFPVLSQIKP 105 T R+ K + RCP ++R+P L IKP Sbjct: 375 TAPSRLSKGFITEGGIRCPAIIRYPPL--IKP 404 >SPAC926.09c |fas1||fatty acid synthase beta subunit Fas1|Schizosaccharomyces pombe|chr 1|||Manual Length = 2073 Score = 25.0 bits (52), Expect = 9.3 Identities = 13/30 (43%), Positives = 19/30 (63%), Gaps = 2/30 (6%) Frame = -3 Query: 581 GRDVINASLYSRLLGIPRLW--GIIATPIP 498 GR ++ L SR+LG+P LW G+ T +P Sbjct: 565 GRVYVDTRL-SRMLGLPPLWVAGMTPTSVP 593 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,696,544 Number of Sequences: 5004 Number of extensions: 54955 Number of successful extensions: 116 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 109 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 116 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 287744314 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -