BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00262 (643 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) 73 3e-13 SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) 70 1e-12 SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) 69 4e-12 SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) 65 5e-11 SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) 64 9e-11 SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 3e-10 SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) 62 5e-10 SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) 59 3e-09 SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) 56 3e-08 SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 3e-07 SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) 52 5e-07 SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 51 7e-07 SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) 51 7e-07 SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) 51 7e-07 SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) 51 7e-07 SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) 51 7e-07 SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) 51 7e-07 SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) 51 7e-07 SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) 51 7e-07 SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) 51 7e-07 SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) 51 7e-07 SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) 51 7e-07 SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) 50 2e-06 SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) 48 5e-06 SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) 48 9e-06 SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) 39 0.003 SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.005 SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.028 SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) 34 0.11 SB_49320| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.46 SB_45504| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_28934| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_26329| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) 31 0.80 SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_12244| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_9373| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_7163| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_55659| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_45187| Best HMM Match : Sulfolobus_pRN (HMM E-Value=0.95) 31 0.80 SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_9584| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_3231| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.80 SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_42282| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_13374| Best HMM Match : Cornifin (HMM E-Value=0.34) 29 2.4 SB_57049| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_48780| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_16123| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_15343| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_13868| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_966| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_394| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_52036| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_46164| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_1910| Best HMM Match : 7tm_1 (HMM E-Value=0.0013) 28 7.4 SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) 27 9.8 SB_10164| Best HMM Match : Keratin_B2 (HMM E-Value=3.4) 27 9.8 >SB_46117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 72.5 bits (170), Expect = 3e-13 Identities = 42/79 (53%), Positives = 48/79 (60%), Gaps = 1/79 (1%) Frame = +1 Query: 397 MPLDVLGRTRATLKESACSPWPRGPGNPLNSFVLGI-GVAIIPHKRGIPSKREYKLALIT 573 MPLDVL RTRATL S P P G GN + G + ++ ++LALIT Sbjct: 1 MPLDVLDRTRATLTVSRVFPSPEGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALIT 60 Query: 574 SLPFVHTARRYYRLNDLVR 630 SLPFVHTARRYYRLN LVR Sbjct: 61 SLPFVHTARRYYRLNGLVR 79 >SB_54484| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 100 Score = 70.1 bits (164), Expect = 1e-12 Identities = 41/79 (51%), Positives = 47/79 (59%), Gaps = 1/79 (1%) Frame = +1 Query: 397 MPLDVLGRTRATLKESACSPWPRGPGNPLNSFVLGI-GVAIIPHKRGIPSKREYKLALIT 573 MPLDVLGRTRATL S + G GN + G ++ ++LALIT Sbjct: 1 MPLDVLGRTRATLTVSTSLSFAGGVGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALIT 60 Query: 574 SLPFVHTARRYYRLNDLVR 630 SLPFVHTARRYYRLN LVR Sbjct: 61 SLPFVHTARRYYRLNGLVR 79 >SB_21596| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 68.5 bits (160), Expect = 4e-12 Identities = 42/80 (52%), Positives = 49/80 (61%), Gaps = 2/80 (2%) Frame = +1 Query: 397 MPLDVLGRTRATLKESACSPWPR-GPGNPLNSFVLGI-GVAIIPHKRGIPSKREYKLALI 570 MPLDVLGRTRATL S + R G GN + G + ++ ++LALI Sbjct: 1 MPLDVLGRTRATLTVSTSLSFARKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALI 60 Query: 571 TSLPFVHTARRYYRLNDLVR 630 TSLPFVHTARRYYRLN LVR Sbjct: 61 TSLPFVHTARRYYRLNGLVR 80 >SB_22783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 64.9 bits (151), Expect = 5e-11 Identities = 40/80 (50%), Positives = 47/80 (58%), Gaps = 2/80 (2%) Frame = +1 Query: 397 MPLDVLGRTRA-TLKESACSPWPRGPGNPLNSFVLGI-GVAIIPHKRGIPSKREYKLALI 570 MPLDVLGRTR T + P P G GN + G + ++ ++LALI Sbjct: 1 MPLDVLGRTRRYTDGVNESFPRPEGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALI 60 Query: 571 TSLPFVHTARRYYRLNDLVR 630 TSLPFVHTARRYYRLN LVR Sbjct: 61 TSLPFVHTARRYYRLNGLVR 80 >SB_47613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 101 Score = 64.1 bits (149), Expect = 9e-11 Identities = 40/80 (50%), Positives = 47/80 (58%), Gaps = 2/80 (2%) Frame = +1 Query: 397 MPLDVLGRTRATLKESACSPWPR-GPGNPLNSFVLGI-GVAIIPHKRGIPSKREYKLALI 570 MPLDVLGR R TL S + R G GN + G + ++ ++LALI Sbjct: 1 MPLDVLGRPRVTLTVSTSLSFRRKGVGNLVKHRRAGDRSLQLLILNEEFLVSASHQLALI 60 Query: 571 TSLPFVHTARRYYRLNDLVR 630 TSLPFVHTARRYYRLN LVR Sbjct: 61 TSLPFVHTARRYYRLNGLVR 80 >SB_1429| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 62.5 bits (145), Expect = 3e-10 Identities = 32/48 (66%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = +1 Query: 490 FVLGIGVAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 + L + +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 74 YQLSMIIAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 121 >SB_58476| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_58117| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_57051| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_56735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_47630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_42617| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_40153| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_36940| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 90 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 28 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 69 >SB_35936| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_30350| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 97 Score = 61.7 bits (143), Expect = 5e-10 Identities = 36/73 (49%), Positives = 41/73 (56%), Gaps = 1/73 (1%) Frame = +1 Query: 415 GRTRATLKESACSPWPRGPGNPLNSFVLGI-GVAIIPHKRGIPSKREYKLALITSLPFVH 591 GRTRATL P P G GN + G ++ ++LALITSLPFVH Sbjct: 4 GRTRATLTGQRVFPSPEGGGNLVKHRRAGDRSCKLLIFNEEFLVSASHQLALITSLPFVH 63 Query: 592 TARRYYRLNDLVR 630 TARRYYRLN LVR Sbjct: 64 TARRYYRLNGLVR 76 >SB_22548| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_21972| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_21946| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_19156| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_18757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_18471| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_8094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_4926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_57173| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_55458| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_52064| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_41855| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_41222| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_40101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_30251| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_29656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_25406| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_24218| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_20995| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_20749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_20494| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_18082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_16129| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_14158| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_10058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_6526| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_1346| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 64 Score = 61.7 bits (143), Expect = 5e-10 Identities = 31/42 (73%), Positives = 35/42 (83%), Gaps = 1/42 (2%) Frame = +1 Query: 508 VAIIPHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 43 >SB_16777| Best HMM Match : Ribosomal_L15e (HMM E-Value=2.4) Length = 167 Score = 58.8 bits (136), Expect = 3e-09 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 1/38 (2%) Frame = +1 Query: 520 PHKRGIPS-KREYKLALITSLPFVHTARRYYRLNDLVR 630 P +RGIPS ++LALITSLPFVHTARRYYRLN LVR Sbjct: 7 PLERGIPSVSASHQLALITSLPFVHTARRYYRLNGLVR 44 >SB_50595| Best HMM Match : Herpes_US9 (HMM E-Value=2.5) Length = 101 Score = 55.6 bits (128), Expect = 3e-08 Identities = 37/80 (46%), Positives = 45/80 (56%), Gaps = 2/80 (2%) Frame = +1 Query: 397 MPLDVLGR-TRATLKESACSPWPRGPGNPLNSFVLGI-GVAIIPHKRGIPSKREYKLALI 570 MPLDVLGR R T + +G GN + G + ++ ++LALI Sbjct: 1 MPLDVLGRHARYTDGVNESFLRRKGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALI 60 Query: 571 TSLPFVHTARRYYRLNDLVR 630 TSLPFVHTARRYYRLN LVR Sbjct: 61 TSLPFVHTARRYYRLNGLVR 80 >SB_1081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 63 Score = 52.4 bits (120), Expect = 3e-07 Identities = 26/41 (63%), Positives = 29/41 (70%) Frame = +1 Query: 508 VAIIPHKRGIPSKREYKLALITSLPFVHTARRYYRLNDLVR 630 +AII ++LALITSLPFVHTARRYYRLN LVR Sbjct: 2 IAIIDLNEEFLVSASHQLALITSLPFVHTARRYYRLNGLVR 42 >SB_55150| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 51.6 bits (118), Expect = 5e-07 Identities = 29/70 (41%), Positives = 40/70 (57%), Gaps = 1/70 (1%) Frame = +1 Query: 424 RATLKESACSPWPRGPGNPLNSFVLGI-GVAIIPHKRGIPSKREYKLALITSLPFVHTAR 600 R ++++ C+ G GN + G + ++ ++LALITSLPFVHTAR Sbjct: 121 RKVIRKATCARCFAGVGNLVKHRRAGDRSLQLLIFNEEFLVSASHQLALITSLPFVHTAR 180 Query: 601 RYYRLNDLVR 630 RYYRLN LVR Sbjct: 181 RYYRLNGLVR 190 >SB_56296| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 98 HQLALITSLPFVHTARRYYRLNGLVR 123 >SB_56250| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 216 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 170 HQLALITSLPFVHTARRYYRLNGLVR 195 >SB_49567| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 117 HQLALITSLPFVHTARRYYRLNGLVR 142 >SB_48355| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 52 HQLALITSLPFVHTARRYYRLNGLVR 77 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 408 CPGPHARYTEGISMFSLA*R-PGQPAELLRAGD 503 C GPHARYT+G++ L + G + RAGD Sbjct: 2 CSGPHARYTDGVNESFLRRKGVGNLVKHRRAGD 34 >SB_44725| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 45 HQLALITSLPFVHTARRYYRLNGLVR 70 >SB_26770| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 31 HQLALITSLPFVHTARRYYRLNGLVR 56 >SB_17609| Best HMM Match : Herpes_US9 (HMM E-Value=4.7) Length = 98 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 52 HQLALITSLPFVHTARRYYRLNGLVR 77 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/33 (45%), Positives = 20/33 (60%), Gaps = 1/33 (3%) Frame = +3 Query: 408 CPGPHARYTEGISMFSLA*R-PGQPAELLRAGD 503 C GPHARYT+G++ L + G + RAGD Sbjct: 2 CSGPHARYTDGVNESFLRRKGVGNLVKHRRAGD 34 >SB_12257| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 255 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 209 HQLALITSLPFVHTARRYYRLNGLVR 234 >SB_11205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 117 HQLALITSLPFVHTARRYYRLNGLVR 142 >SB_9377| Best HMM Match : DUF1550 (HMM E-Value=4) Length = 91 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 45 HQLALITSLPFVHTARRYYRLNGLVR 70 >SB_45982| Best HMM Match : TIL (HMM E-Value=2.5) Length = 211 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 165 HQLALITSLPFVHTARRYYRLNGLVR 190 >SB_45011| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 117 HQLALITSLPFVHTARRYYRLNGLVR 142 >SB_42300| Best HMM Match : Filament_head (HMM E-Value=4.9) Length = 152 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 106 HQLALITSLPFVHTARRYYRLNGLVR 131 >SB_35044| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 199 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 31 HQLALITSLPFVHTARRYYRLNGLVR 56 >SB_28753| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 98 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 52 HQLALITSLPFVHTARRYYRLNGLVR 77 Score = 29.9 bits (64), Expect = 1.8 Identities = 15/33 (45%), Positives = 19/33 (57%), Gaps = 1/33 (3%) Frame = +3 Query: 408 CPGPHARYTEGIS-MFSLA*RPGQPAELLRAGD 503 C GPHARYT+G++ F G + RAGD Sbjct: 2 CSGPHARYTDGVNESFLSTEGVGNLVKHRRAGD 34 >SB_23403| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 137 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 91 HQLALITSLPFVHTARRYYRLNGLVR 116 >SB_19267| Best HMM Match : TIL (HMM E-Value=2.5) Length = 214 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 168 HQLALITSLPFVHTARRYYRLNGLVR 193 >SB_18209| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 180 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 134 HQLALITSLPFVHTARRYYRLNGLVR 159 >SB_16598| Best HMM Match : TIL (HMM E-Value=2.5) Length = 216 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 170 HQLALITSLPFVHTARRYYRLNGLVR 195 >SB_15948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 120 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 74 HQLALITSLPFVHTARRYYRLNGLVR 99 >SB_9699| Best HMM Match : FYVE (HMM E-Value=9.8) Length = 163 Score = 51.2 bits (117), Expect = 7e-07 Identities = 23/26 (88%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN LVR Sbjct: 117 HQLALITSLPFVHTARRYYRLNGLVR 142 >SB_45893| Best HMM Match : Arc (HMM E-Value=3.3) Length = 186 Score = 50.0 bits (114), Expect = 2e-06 Identities = 22/26 (84%), Positives = 25/26 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTARRYYRLN L+R Sbjct: 31 HQLALITSLPFVHTARRYYRLNGLLR 56 >SB_51709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 77 Score = 49.2 bits (112), Expect = 3e-06 Identities = 22/25 (88%), Positives = 24/25 (96%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLV 627 ++LALITSLPFVHTARRYYRLN LV Sbjct: 31 HQLALITSLPFVHTARRYYRLNGLV 55 >SB_49087| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 163 Score = 48.4 bits (110), Expect = 5e-06 Identities = 22/26 (84%), Positives = 24/26 (92%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDLVR 630 ++LALITSLPFVHTAR YYRLN LVR Sbjct: 117 HQLALITSLPFVHTARGYYRLNGLVR 142 >SB_1551| Best HMM Match : WD40 (HMM E-Value=0.0019) Length = 101 Score = 47.6 bits (108), Expect = 9e-06 Identities = 21/24 (87%), Positives = 23/24 (95%) Frame = +1 Query: 553 YKLALITSLPFVHTARRYYRLNDL 624 ++LALITSLPFVHTARRYYRLN L Sbjct: 31 HQLALITSLPFVHTARRYYRLNGL 54 >SB_46672| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 44.4 bits (100), Expect = 8e-05 Identities = 19/21 (90%), Positives = 20/21 (95%) Frame = -1 Query: 637 RKTSLNHSIGSSDGRCVQRAG 575 +K SLNHSIGSSDGRCVQRAG Sbjct: 22 QKASLNHSIGSSDGRCVQRAG 42 >SB_14822| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 79 Score = 39.1 bits (87), Expect = 0.003 Identities = 17/19 (89%), Positives = 18/19 (94%) Frame = -1 Query: 628 SLNHSIGSSDGRCVQRAGT 572 S +HSIGSSDGRCVQRAGT Sbjct: 34 SPSHSIGSSDGRCVQRAGT 52 >SB_34797| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 38.3 bits (85), Expect = 0.005 Identities = 24/50 (48%), Positives = 27/50 (54%), Gaps = 1/50 (2%) Frame = -3 Query: 536 IPRLWGIIATPIPSTKE-FSGLPGPLGQGEHADSFSVARVRPRTSKGITD 390 IPR IIA P + P + D+ SVARVRPRTSKGITD Sbjct: 2 IPRSRSIIAMIYPQHDDVLQDYPRLPAKERLVDTVSVARVRPRTSKGITD 51 >SB_27909| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 35.9 bits (79), Expect = 0.028 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 443 DSFSVARVRPRTSKGITD 390 D+ SVARVRPRTSKGITD Sbjct: 132 DTVSVARVRPRTSKGITD 149 Score = 30.7 bits (66), Expect = 1.1 Identities = 12/17 (70%), Positives = 15/17 (88%) Frame = -1 Query: 637 RKTSLNHSIGSSDGRCV 587 +K S+NHSIGSSDGR + Sbjct: 90 QKASVNHSIGSSDGRSI 106 >SB_4723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 89 Score = 35.9 bits (79), Expect = 0.028 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 443 DSFSVARVRPRTSKGITD 390 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 Score = 31.9 bits (69), Expect = 0.46 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 637 RKTSLNHSIGSSDGRCV 587 +K SLNHSIGSSDGR + Sbjct: 22 QKASLNHSIGSSDGRSI 38 >SB_57065| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.028 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 443 DSFSVARVRPRTSKGITD 390 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 Score = 31.9 bits (69), Expect = 0.46 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 637 RKTSLNHSIGSSDGRCV 587 +K SLNHSIGSSDGR + Sbjct: 22 QKASLNHSIGSSDGRSI 38 >SB_23080| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 86 Score = 35.9 bits (79), Expect = 0.028 Identities = 16/18 (88%), Positives = 17/18 (94%) Frame = -3 Query: 443 DSFSVARVRPRTSKGITD 390 D+ SVARVRPRTSKGITD Sbjct: 64 DTVSVARVRPRTSKGITD 81 Score = 31.9 bits (69), Expect = 0.46 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 637 RKTSLNHSIGSSDGRCV 587 +K SLNHSIGSSDGR + Sbjct: 22 QKASLNHSIGSSDGRSI 38 >SB_29700| Best HMM Match : DUF551 (HMM E-Value=8.8) Length = 86 Score = 33.9 bits (74), Expect = 0.11 Identities = 15/18 (83%), Positives = 16/18 (88%) Frame = -3 Query: 443 DSFSVARVRPRTSKGITD 390 D+ SVA VRPRTSKGITD Sbjct: 64 DTVSVAHVRPRTSKGITD 81 Score = 31.9 bits (69), Expect = 0.46 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 637 RKTSLNHSIGSSDGRCV 587 +K SLNHSIGSSDGR + Sbjct: 22 QKASLNHSIGSSDGRSI 38 >SB_49320| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 75 Score = 31.9 bits (69), Expect = 0.46 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 637 RKTSLNHSIGSSDGRCV 587 +K SLNHSIGSSDGR + Sbjct: 22 QKASLNHSIGSSDGRSI 38 >SB_25769| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 82 Score = 31.9 bits (69), Expect = 0.46 Identities = 13/17 (76%), Positives = 15/17 (88%) Frame = -1 Query: 637 RKTSLNHSIGSSDGRCV 587 +K SLNHSIGSSDGR + Sbjct: 22 QKASLNHSIGSSDGRSI 38 Score = 31.5 bits (68), Expect = 0.60 Identities = 14/18 (77%), Positives = 16/18 (88%) Frame = -3 Query: 443 DSFSVARVRPRTSKGITD 390 D+ SVARVR +TSKGITD Sbjct: 64 DTVSVARVRAKTSKGITD 81 >SB_45504| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_39615| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_35246| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_28934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_26329| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_15734| Best HMM Match : Adeno_shaft (HMM E-Value=6.4) Length = 248 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_14812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_12244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_9373| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_7163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_56749| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_55659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 69 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_45187| Best HMM Match : Sulfolobus_pRN (HMM E-Value=0.95) Length = 108 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_32095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_9584| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 193 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_3231| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 110 Score = 31.1 bits (67), Expect = 0.80 Identities = 13/15 (86%), Positives = 14/15 (93%) Frame = -1 Query: 637 RKTSLNHSIGSSDGR 593 +K SLNHSIGSSDGR Sbjct: 22 QKASLNHSIGSSDGR 36 >SB_41723| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 38 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/16 (87%), Positives = 14/16 (87%) Frame = +1 Query: 397 MPLDVLGRTRATLKES 444 MPLDVLGRTRATL S Sbjct: 1 MPLDVLGRTRATLTVS 16 >SB_42282| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 572 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/44 (36%), Positives = 27/44 (61%) Frame = -1 Query: 259 VSSLPELTRQIAPPTKNGHAPPPTESRKSC*SVNPSGVRAW*DF 128 +++ PE T ++A PT + APPP + S S P+G+R+ D+ Sbjct: 113 ITNQPESTAKVAVPTTSP-APPPPSTVTSTTSKPPTGLRSKYDY 155 >SB_30664| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 111 Score = 29.9 bits (64), Expect = 1.8 Identities = 13/13 (100%), Positives = 13/13 (100%) Frame = +1 Query: 397 MPLDVLGRTRATL 435 MPLDVLGRTRATL Sbjct: 1 MPLDVLGRTRATL 13 >SB_13374| Best HMM Match : Cornifin (HMM E-Value=0.34) Length = 1197 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -2 Query: 153 PVSGPGEISRVESN*AAGSTPGGALPSIPLSFSFAT 46 P S PG S A STPG A+ SIP + S +T Sbjct: 1015 PSSTPGAASSTTPGAAPSSTPGAAMSSIPGATSSST 1050 >SB_57049| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 50 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 637 RKTSLNHSIGSSDG 596 +K SLNHSIGSSDG Sbjct: 36 QKASLNHSIGSSDG 49 >SB_48780| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 637 RKTSLNHSIGSSDG 596 +K SLNHSIGSSDG Sbjct: 22 QKASLNHSIGSSDG 35 >SB_16123| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 637 RKTSLNHSIGSSDG 596 +K SLNHSIGSSDG Sbjct: 22 QKASLNHSIGSSDG 35 >SB_15343| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 637 RKTSLNHSIGSSDG 596 +K SLNHSIGSSDG Sbjct: 22 QKASLNHSIGSSDG 35 >SB_13868| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 56 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 637 RKTSLNHSIGSSDG 596 +K SLNHSIGSSDG Sbjct: 42 QKASLNHSIGSSDG 55 >SB_966| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 637 RKTSLNHSIGSSDG 596 +K SLNHSIGSSDG Sbjct: 22 QKASLNHSIGSSDG 35 >SB_394| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 637 RKTSLNHSIGSSDG 596 +K SLNHSIGSSDG Sbjct: 22 QKASLNHSIGSSDG 35 >SB_52036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 36 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/14 (85%), Positives = 13/14 (92%) Frame = -1 Query: 637 RKTSLNHSIGSSDG 596 +K SLNHSIGSSDG Sbjct: 22 QKASLNHSIGSSDG 35 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 411 PGPHARYTEGISMFSLA*RPGQPAELLRAGD-WGCNYP 521 PGP +R T IS+ S + PG P L R W N P Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPLVLERPPPRWSSNSP 58 >SB_17203| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 2672 Score = 28.7 bits (61), Expect = 4.2 Identities = 17/44 (38%), Positives = 20/44 (45%) Frame = -3 Query: 521 GIIATPIPSTKEFSGLPGPLGQGEHADSFSVARVRPRTSKGITD 390 GI TPIP+ GLP G A S + P TSK +D Sbjct: 2136 GIRPTPIPAADHRLGLPSRAGIASAATSTASHTSAPSTSKRASD 2179 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 411 PGPHARYTEGISMFSLA*RPGQPAELLRAGD-WGCNYP 521 PGP +R T IS+ S + PG P L R W N P Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPLVLERPPPRWSSNSP 58 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 411 PGPHARYTEGISMFSLA*RPGQPAELLRAGD-WGCNYP 521 PGP +R T IS+ S + PG P L R W N P Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPLVLERPPPRWSSNSP 58 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 411 PGPHARYTEGISMFSLA*RPGQPAELLRAGD-WGCNYP 521 PGP +R T IS+ S + PG P L R W N P Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPLVLERPPPRWSSNSP 58 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 411 PGPHARYTEGISMFSLA*RPGQPAELLRAGD-WGCNYP 521 PGP +R T IS+ S + PG P L R W N P Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPLVLERPPPRWSSNSP 58 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 411 PGPHARYTEGISMFSLA*RPGQPAELLRAGD-WGCNYP 521 PGP +R T IS+ S + PG P L R W N P Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPLVLERPPPRWSSNSP 58 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 411 PGPHARYTEGISMFSLA*RPGQPAELLRAGD-WGCNYP 521 PGP +R T IS+ S + PG P L R W N P Sbjct: 21 PGPPSRSTVSISLISNSCSPGDPLVLERPPPRWSSNSP 58 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.7 bits (61), Expect = 4.2 Identities = 16/38 (42%), Positives = 19/38 (50%), Gaps = 1/38 (2%) Frame = +3 Query: 411 PGPHARYTEGISMFSLA*RPGQPAELLRAGD-WGCNYP 521 PGP +R T IS+ S + PG P L R W N P Sbjct: 19 PGPPSRSTVSISLISNSCSPGDPLVLERPPPRWSSNSP 56 >SB_46164| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 784 Score = 28.3 bits (60), Expect = 5.6 Identities = 20/53 (37%), Positives = 28/53 (52%), Gaps = 1/53 (1%) Frame = -3 Query: 164 CQSFRCPGLVRFPVLSQIKPQ-APLLVVPFRQFL*VSALQPYSPRSPKSLVSR 9 C S +CPG V +P + P+ AP P R++ L SPRSP++ SR Sbjct: 343 CASGKCPGCVYYPGMVPRSPRDAP--KEP-REYASPPPLPSKSPRSPRTSESR 392 >SB_1910| Best HMM Match : 7tm_1 (HMM E-Value=0.0013) Length = 550 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/28 (39%), Positives = 17/28 (60%) Frame = +1 Query: 523 HKRGIPSKREYKLALITSLPFVHTARRY 606 H I +++ +L +TS P VHT R+Y Sbjct: 146 HHSSIITRKSARLVKLTSTPSVHTRRKY 173 >SB_59756| Best HMM Match : cNMP_binding (HMM E-Value=5.7e-21) Length = 858 Score = 27.5 bits (58), Expect = 9.8 Identities = 20/60 (33%), Positives = 27/60 (45%), Gaps = 3/60 (5%) Frame = +3 Query: 33 PGGVWLQS*NLKELTEGHHQEWSLRLNLTQH---GKSHQARTPEGLTD*QLFLDSVGGGA 203 P W+ + NLK + G WSL L+ G H P+ LTD L + S+ GA Sbjct: 475 PDDSWVSTSNLKTASPGEQYSWSLFRALSHMLCIGYGHY--PPQNLTDLWLTVCSMTAGA 532 >SB_10164| Best HMM Match : Keratin_B2 (HMM E-Value=3.4) Length = 428 Score = 27.5 bits (58), Expect = 9.8 Identities = 21/69 (30%), Positives = 33/69 (47%) Frame = -1 Query: 385 YCSISCGSKTPVPLRRILIRRQ*VARHEAAHT*ITTPI*QARVSSLPELTRQIAPPTKNG 206 YCS P+ LR+I+I + VA+ A+ + I + R S L + ++ +G Sbjct: 193 YCSRFVAVVDPL-LRQIVISQFKVAKASIAYRIVLYFIHRTRYYSGARLDQPLSARRLDG 251 Query: 205 HAPPPTESR 179 H PP SR Sbjct: 252 HNTPPCRSR 260 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 21,713,012 Number of Sequences: 59808 Number of extensions: 488602 Number of successful extensions: 1328 Number of sequences better than 10.0: 123 Number of HSP's better than 10.0 without gapping: 1069 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1311 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1620947750 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -