BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00262 (643 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value L13740-1|AAA36763.1| 598|Homo sapiens TR3 orphan receptor protein. 30 8.0 >L13740-1|AAA36763.1| 598|Homo sapiens TR3 orphan receptor protein. Length = 598 Score = 29.9 bits (64), Expect = 8.0 Identities = 19/44 (43%), Positives = 24/44 (54%), Gaps = 3/44 (6%) Frame = -3 Query: 521 GIIATPIPSTKEFSGLPGPLGQGEHA---DSFSVARVRPRTSKG 399 GI+ TP+ STK SG PGP +G A D+ S RT +G Sbjct: 244 GILDTPVTSTKARSGAPGP-SEGRCAVCGDNASCQHYGVRTCEG 286 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 108,034,524 Number of Sequences: 237096 Number of extensions: 2577770 Number of successful extensions: 5987 Number of sequences better than 10.0: 1 Number of HSP's better than 10.0 without gapping: 5351 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5975 length of database: 76,859,062 effective HSP length: 87 effective length of database: 56,231,710 effective search space used: 7085195460 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -