Bombyx BLAST Result against tribolium

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00261
         (723 letters)

Database: tribolium 
           336 sequences; 122,585 total letters

Searching.......................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ...    22   5.8  
AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ...    22   5.8  
AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ...    22   5.8  
AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ...    22   5.8  
AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory recept...    21   7.6  
AJ621748-1|CAF21851.1|  228|Tribolium castaneum zinc finger tran...    21   7.6  

>AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase
           variant 2 protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 4/11 (36%), Positives = 7/11 (63%)
 Frame = -2

Query: 284 WRWCNVYFHWI 252
           W WC ++  W+
Sbjct: 131 WMWCLIFAFWV 141


>AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase
           variant 1 protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 4/11 (36%), Positives = 7/11 (63%)
 Frame = -2

Query: 284 WRWCNVYFHWI 252
           W WC ++  W+
Sbjct: 131 WMWCLIFAFWV 141


>AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase
           CHS1B protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 4/11 (36%), Positives = 7/11 (63%)
 Frame = -2

Query: 284 WRWCNVYFHWI 252
           W WC ++  W+
Sbjct: 131 WMWCLIFAFWV 141


>AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase
           CHS1A protein.
          Length = 1558

 Score = 21.8 bits (44), Expect = 5.8
 Identities = 4/11 (36%), Positives = 7/11 (63%)
 Frame = -2

Query: 284 WRWCNVYFHWI 252
           W WC ++  W+
Sbjct: 131 WMWCLIFAFWV 141


>AM292378-1|CAL23190.2|  387|Tribolium castaneum gustatory receptor
           candidate 57 protein.
          Length = 387

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 10/35 (28%), Positives = 18/35 (51%)
 Frame = +1

Query: 571 FDLFVPYLKTFNSDSFDYESLAKVIMCL*DGRTFF 675
           F   +P  + F S    ++++ K ++C  DGR  F
Sbjct: 165 FHSVLPIKRFFTSLGIAFDNIMKNLICEIDGRHEF 199


>AJ621748-1|CAF21851.1|  228|Tribolium castaneum zinc finger
           transcription factor protein.
          Length = 228

 Score = 21.4 bits (43), Expect = 7.6
 Identities = 8/21 (38%), Positives = 11/21 (52%)
 Frame = -1

Query: 255 DYFSIRR*PSSCKCDSCRTER 193
           DYFS+++ PS      C   R
Sbjct: 164 DYFSVKKLPSPASDSECFDRR 184


  Database: tribolium
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 122,585
  Number of sequences in database:  336
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 163,813
Number of Sequences: 336
Number of extensions: 3413
Number of successful extensions: 14
Number of sequences better than 10.0: 6
Number of HSP's better than 10.0 without gapping: 14
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 14
length of database: 122,585
effective HSP length: 55
effective length of database: 104,105
effective search space used: 19259425
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)