BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00261 (723 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At2g37680.1 68415.m04621 phytochrome A specific signal transduct... 35 0.047 At5g38300.1 68418.m04622 expressed protein predicted protein, rice 30 1.4 >At2g37680.1 68415.m04621 phytochrome A specific signal transduction component (PAT3) / far-red elongated hypocotyl protein 1 (FHY1) identical to phytochrome A specific signal transduction component PAT3 [Arabidopsis thaliana] gi|19421998|gb|AAL87850; identical to far-red elongated hypocotyl protein 1 [Arabidopsis thaliana] gi|17148773|gb|AAL35819 Length = 313 Score = 35.1 bits (77), Expect = 0.047 Identities = 13/25 (52%), Positives = 16/25 (64%) Frame = +1 Query: 514 FLTRKWDADEDVDRKHWSKFDLFVP 588 F T KW+A + D +HWSKF F P Sbjct: 78 FYTGKWEATREDDMRHWSKFPSFSP 102 Score = 28.7 bits (61), Expect = 4.1 Identities = 13/43 (30%), Positives = 27/43 (62%) Frame = +3 Query: 312 TKSLLYNGSKFQGHQKSKGNSYEVEVVLQHVDEENSYLCGYLK 440 T + ++G++ +Q+ K ++ V V +Q +D E+ YLCG ++ Sbjct: 10 TPAQAFSGTQNVSNQQ-KEEAWRVNVQIQGIDLEHGYLCGTME 51 >At5g38300.1 68418.m04622 expressed protein predicted protein, rice Length = 263 Score = 30.3 bits (65), Expect = 1.4 Identities = 22/50 (44%), Positives = 28/50 (56%), Gaps = 6/50 (12%) Frame = +3 Query: 237 VLWKNN--PVKVD-ITPPPP-ANSKQPGVTKSLLYNGSK--FQGHQKSKG 368 V+ K N PV ++ ITPPPP + S+ GV GSK G +KSKG Sbjct: 156 VIRKENRRPVNINTITPPPPTSKSRNGGVLTGSASRGSKSASAGEKKSKG 205 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,336,241 Number of Sequences: 28952 Number of extensions: 277016 Number of successful extensions: 927 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 825 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 921 length of database: 12,070,560 effective HSP length: 79 effective length of database: 9,783,352 effective search space used: 1575119672 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -