BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00260 (758 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthol... 26 0.28 AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxida... 24 1.1 AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical pro... 23 2.0 AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase ... 22 6.1 AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase ... 22 6.1 AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase ... 22 6.1 AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase ... 22 6.1 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 8.1 >AF217810-1|AAF71998.1| 431|Tribolium castaneum fork head orthologue protein. Length = 431 Score = 26.2 bits (55), Expect = 0.28 Identities = 11/23 (47%), Positives = 15/23 (65%) Frame = +1 Query: 454 QRNFQHSQHSLMVK*FHPISLSN 522 Q+N H + S MV HP+SLS+ Sbjct: 319 QQNMSHEELSAMVNRCHPLSLSS 341 >AY884064-1|AAX84205.1| 683|Tribolium castaneum pro-phenol oxidase subunit 2 protein. Length = 683 Score = 24.2 bits (50), Expect = 1.1 Identities = 13/56 (23%), Positives = 27/56 (48%), Gaps = 4/56 (7%) Frame = +2 Query: 566 SKFDLFVPYLKTFNSDSFDY----ESLAKADYVFMRWKEHFLVPDHTIKDINGASF 721 S+ + +P+ +TF + + E LA+ ++ W +H L+P T + + F Sbjct: 546 SQSSVTIPFERTFRNLDLNRPQGGEELAQFNFCGCGWPQHMLIPKGTPEGMKSQLF 601 >AM712904-1|CAN84643.1| 86|Tribolium castaneum hypothetical protein protein. Length = 86 Score = 23.4 bits (48), Expect = 2.0 Identities = 9/12 (75%), Positives = 11/12 (91%) Frame = +1 Query: 490 VK*FHPISLSNK 525 VK FHP++LSNK Sbjct: 46 VKHFHPLALSNK 57 >AY295880-2|AAQ62694.1| 1558|Tribolium castaneum chitin synthase variant 2 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.1 Identities = 4/11 (36%), Positives = 7/11 (63%) Frame = -1 Query: 284 WRWCNVYFHWI 252 W WC ++ W+ Sbjct: 131 WMWCLIFAFWV 141 >AY295880-1|AAQ62693.1| 1558|Tribolium castaneum chitin synthase variant 1 protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.1 Identities = 4/11 (36%), Positives = 7/11 (63%) Frame = -1 Query: 284 WRWCNVYFHWI 252 W WC ++ W+ Sbjct: 131 WMWCLIFAFWV 141 >AY291476-1|AAQ55060.1| 1558|Tribolium castaneum chitin synthase CHS1B protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.1 Identities = 4/11 (36%), Positives = 7/11 (63%) Frame = -1 Query: 284 WRWCNVYFHWI 252 W WC ++ W+ Sbjct: 131 WMWCLIFAFWV 141 >AY291475-1|AAQ55059.1| 1558|Tribolium castaneum chitin synthase CHS1A protein. Length = 1558 Score = 21.8 bits (44), Expect = 6.1 Identities = 4/11 (36%), Positives = 7/11 (63%) Frame = -1 Query: 284 WRWCNVYFHWI 252 W WC ++ W+ Sbjct: 131 WMWCLIFAFWV 141 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 21.4 bits (43), Expect = 8.1 Identities = 8/21 (38%), Positives = 11/21 (52%) Frame = -3 Query: 255 DYFSIRR*PSSCKCDSCRTER 193 DYFS+++ PS C R Sbjct: 164 DYFSVKKLPSPASDSECFDRR 184 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 171,688 Number of Sequences: 336 Number of extensions: 3687 Number of successful extensions: 15 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 15 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 15 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20338724 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -