BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00259 (694 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding pr... 26 1.3 U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles ... 23 9.1 CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. 23 9.1 >AY146756-1|AAO12071.1| 282|Anopheles gambiae odorant-binding protein AgamOBP40 protein. Length = 282 Score = 25.8 bits (54), Expect = 1.3 Identities = 12/35 (34%), Positives = 18/35 (51%) Frame = +3 Query: 543 ERDEFESFVKRAASLMTAALCSTARNMDLSTLGGR 647 ERD S+V A L+ +L S R + + GG+ Sbjct: 2 ERDRSSSYVAAALLLVCISLASAPRGTEANIFGGK 36 >U50468-1|AAA93472.1| 91|Anopheles gambiae protein ( Anopheles gambiae putativetubulin alpha chain mRNA, complete cds. ). Length = 91 Score = 23.0 bits (47), Expect = 9.1 Identities = 10/26 (38%), Positives = 12/26 (46%) Frame = -2 Query: 99 RYTPTEPRFRIRFIFAVPVASCWPAP 22 R TP+ PR VP +S W P Sbjct: 48 RSTPSSPRLAQASTCPVPCSSIWSRP 73 >CR954256-4|CAJ14145.1| 1494|Anopheles gambiae tensin protein. Length = 1494 Score = 23.0 bits (47), Expect = 9.1 Identities = 20/70 (28%), Positives = 29/70 (41%), Gaps = 5/70 (7%) Frame = -1 Query: 259 PHSLRGTYCSRYVLPPKPLSSAVHIRRTPSARTVESRQRSL---SSYPNRRYGSWDQVHP 89 P ++R S L P P + VH + + T+ R L YP+ S+ + P Sbjct: 1364 PQAIRKAVSSLLALRPLPKPTQVHFKASLQGITLTDNTRQLFFRRHYPSNNV-SFCALDP 1422 Query: 88 D--RTSISDT 65 D R SI T Sbjct: 1423 DDRRWSIQST 1432 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 807,433 Number of Sequences: 2352 Number of extensions: 17457 Number of successful extensions: 32 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 30 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 32 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 70250040 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -