BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00258 (769 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse ... 23 2.7 EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggeri... 23 2.7 AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 ... 22 4.7 AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor ... 22 4.7 AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory recept... 21 8.2 AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory recept... 21 8.2 >U09586-2|AAC47271.1| 712|Tribolium castaneum protease, reverse transcriptase andRNase H protein. Length = 712 Score = 23.0 bits (47), Expect = 2.7 Identities = 7/16 (43%), Positives = 11/16 (68%) Frame = -1 Query: 169 ENHRLCHLVNAFRCLF 122 E +L HL+ +RC+F Sbjct: 269 EKRKLIHLLQEYRCIF 284 >EF222293-1|ABN79653.1| 434|Tribolium castaneum ecdysis triggering hormone receptorisoform A protein. Length = 434 Score = 23.0 bits (47), Expect = 2.7 Identities = 9/28 (32%), Positives = 16/28 (57%) Frame = +1 Query: 40 YYVLKFVAYLIYVRYHVHTILYRQISRK 123 Y +L F ++Y+ ++ ILY +S K Sbjct: 330 YNILYFCRIMVYLNSAINPILYNLMSSK 357 >AJ223627-1|CAA11500.1| 371|Tribolium castaneum orthodenticle-1 protein protein. Length = 371 Score = 22.2 bits (45), Expect = 4.7 Identities = 9/23 (39%), Positives = 12/23 (52%) Frame = +2 Query: 563 SFAFALNSFSHTTSHVDYYQFDY 631 SF + N H TS +YY +Y Sbjct: 283 SFNWTANGHGHNTSSHNYYAQNY 305 >AJ005083-1|CAB65469.1| 585|Tribolium castaneum signal receptor protein protein. Length = 585 Score = 22.2 bits (45), Expect = 4.7 Identities = 8/18 (44%), Positives = 11/18 (61%) Frame = -2 Query: 429 STN*CM*KRNCIHNKNYF 376 STN C + C+ NKN + Sbjct: 104 STNPCENQATCVQNKNQY 121 >AM292379-1|CAL23191.2| 376|Tribolium castaneum gustatory receptor candidate 58 protein. Length = 376 Score = 21.4 bits (43), Expect = 8.2 Identities = 9/30 (30%), Positives = 16/30 (53%) Frame = +1 Query: 28 ICLIYYVLKFVAYLIYVRYHVHTILYRQIS 117 IC + + ++IYVR + I + +IS Sbjct: 47 ICFLLSTILGTCWIIYVRIYCKEIRFFEIS 76 >AM292354-1|CAL23166.1| 321|Tribolium castaneum gustatory receptor candidate 33 protein. Length = 321 Score = 21.4 bits (43), Expect = 8.2 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 37 IYYVLKFVAYLIYVRYHVHTILY 105 +YY+L FV ++YV + + Y Sbjct: 99 LYYLLLFVINVLYVLTLCYAVYY 121 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 176,158 Number of Sequences: 336 Number of extensions: 3870 Number of successful extensions: 13 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 13 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 13 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 20650031 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -