BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00257 (798 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 4e-05 SB_51502| Best HMM Match : TPR_2 (HMM E-Value=0) 31 1.1 SB_37524| Best HMM Match : p450 (HMM E-Value=0) 30 2.5 SB_51594| Best HMM Match : p450 (HMM E-Value=3.5e-35) 29 4.4 SB_37363| Best HMM Match : TPR_2 (HMM E-Value=0) 29 4.4 SB_29141| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.4 SB_4909| Best HMM Match : TPR_2 (HMM E-Value=0) 29 5.8 SB_5761| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 5.8 >SB_47984| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 231 Score = 46.0 bits (104), Expect = 4e-05 Identities = 20/25 (80%), Positives = 24/25 (96%) Frame = +1 Query: 493 NKKSCLKLEKLDTDLKNYKTNSIKK 567 +KK+ LKLEKLDTDLKNYK+NSIK+ Sbjct: 15 SKKAALKLEKLDTDLKNYKSNSIKE 39 >SB_51502| Best HMM Match : TPR_2 (HMM E-Value=0) Length = 1161 Score = 31.1 bits (67), Expect = 1.1 Identities = 13/42 (30%), Positives = 21/42 (50%) Frame = +3 Query: 561 QESIRRGHDDLGDHYLDCGDLTSALKCYSRARDYCTSGKHLV 686 Q++++ ++LG Y GD A KCY + D C +V Sbjct: 449 QQNVQPNLEELGLLYAKSGDFNEASKCYEKLLDLCLKNGDVV 490 >SB_37524| Best HMM Match : p450 (HMM E-Value=0) Length = 362 Score = 29.9 bits (64), Expect = 2.5 Identities = 12/52 (23%), Positives = 29/52 (55%) Frame = +3 Query: 336 LKMAISYVMTTYNVNLYHTLHKKLSEAVASAGLPDIAGSQDIPVLDTIWVES 491 L A+ Y++ +N ++ LHK++ + + P ++ +++PVL+ E+ Sbjct: 177 LGWAVIYLL--HNPDVQERLHKEIDDVIGRDAFPQLSKRKELPVLEAFTAET 226 >SB_51594| Best HMM Match : p450 (HMM E-Value=3.5e-35) Length = 1208 Score = 29.1 bits (62), Expect = 4.4 Identities = 14/52 (26%), Positives = 29/52 (55%) Frame = +3 Query: 336 LKMAISYVMTTYNVNLYHTLHKKLSEAVASAGLPDIAGSQDIPVLDTIWVES 491 L AI+Y++ +N + LHK++ + + P ++ ++IPVL+ E+ Sbjct: 1077 LSWAIAYLL--HNPGVQARLHKEIDQVIGRDVSPKLSQRKNIPVLEAFTAET 1126 >SB_37363| Best HMM Match : TPR_2 (HMM E-Value=0) Length = 936 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 564 ESIRRGHDDLGDHYLDCGDLTSALKCYSRARDYCTSGKHLV 686 E+++ +LG Y GD A KCY + D C +V Sbjct: 571 ENVQPNLGELGVLYTKSGDFNEANKCYEKQLDLCLKNGDVV 611 >SB_29141| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1331 Score = 29.1 bits (62), Expect = 4.4 Identities = 13/41 (31%), Positives = 19/41 (46%) Frame = +3 Query: 564 ESIRRGHDDLGDHYLDCGDLTSALKCYSRARDYCTSGKHLV 686 E+++ +LG Y GD A KCY + D C +V Sbjct: 622 ENVQPNLGELGVLYTKSGDFNEANKCYEKQLDLCLKNGDVV 662 >SB_4909| Best HMM Match : TPR_2 (HMM E-Value=0) Length = 1307 Score = 28.7 bits (61), Expect = 5.8 Identities = 12/34 (35%), Positives = 17/34 (50%) Frame = +3 Query: 564 ESIRRGHDDLGDHYLDCGDLTSALKCYSRARDYC 665 E+++ +LG Y GD A KCY + D C Sbjct: 614 ENVQPNLAELGGLYTKSGDFNEANKCYEKLLDSC 647 >SB_5761| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 887 Score = 28.7 bits (61), Expect = 5.8 Identities = 17/66 (25%), Positives = 30/66 (45%), Gaps = 8/66 (12%) Frame = +3 Query: 564 ESIRRGHDDLGDHYLDCGDLTSALKCYSRARDYC--------TSGKHLVMMCLNVVKVSV 719 E+++ + G Y GD A KCY + D C + HL+M+C + V+ Sbjct: 224 ENVQPNLAERGGLYTKSGDFNEANKCYEKLLDSCLKNGDVVGQADTHLMMVCCTCLNVTT 283 Query: 720 YLQNWA 737 ++ W+ Sbjct: 284 -IRLWS 288 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 23,074,166 Number of Sequences: 59808 Number of extensions: 461431 Number of successful extensions: 1161 Number of sequences better than 10.0: 8 Number of HSP's better than 10.0 without gapping: 1084 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1161 length of database: 16,821,457 effective HSP length: 81 effective length of database: 11,977,009 effective search space used: 2203769656 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -