BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00257 (798 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly pro... 27 0.27 AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly pro... 25 0.62 DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor pro... 24 1.4 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 22 7.6 EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. 22 7.6 >AF004842-1|AAD01205.1| 598|Apis mellifera major royal jelly protein MRJP5 protein. Length = 598 Score = 26.6 bits (56), Expect = 0.27 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = -1 Query: 273 NQYMTQLCFQIQGGVFNDVAFRLIVFIIFWGNIN 172 N+YM L ++Q + ND F + F I N+N Sbjct: 542 NEYMMALSMKLQKFINNDYNFNEVNFRILGANVN 575 >AY313893-1|AAQ82184.1| 437|Apis mellifera major royal jelly protein MRJP6 protein. Length = 437 Score = 25.4 bits (53), Expect = 0.62 Identities = 13/38 (34%), Positives = 21/38 (55%) Frame = -1 Query: 285 KVLQNQYMTQLCFQIQGGVFNDVAFRLIVFIIFWGNIN 172 ++ +N+YM L ++Q V ND F + F I N+N Sbjct: 372 RIHKNEYMLALSNRMQKIVNNDFNFDEVNFRILGANVN 409 >DQ151547-1|ABA39280.1| 405|Apis mellifera tyramine receptor protein. Length = 405 Score = 24.2 bits (50), Expect = 1.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = -3 Query: 547 YNFSNQYLAFPVLGSFF 497 YN + Y+ F +GSFF Sbjct: 192 YNMDSSYVIFSAMGSFF 208 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.8 bits (44), Expect = 7.6 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 321 LRLEALKMAISYVMTTYNVNL 383 LRL+A + ++Y TY +N+ Sbjct: 487 LRLKARRACMNYERFTYKINI 507 >EF589162-1|ABQ84439.1| 686|Apis mellifera hexamerin 70c protein. Length = 686 Score = 21.8 bits (44), Expect = 7.6 Identities = 8/21 (38%), Positives = 14/21 (66%) Frame = +3 Query: 321 LRLEALKMAISYVMTTYNVNL 383 LRL+A + ++Y TY +N+ Sbjct: 487 LRLKARRACMNYERFTYKINI 507 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 211,282 Number of Sequences: 438 Number of extensions: 4708 Number of successful extensions: 22 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 25246416 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -