BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00251 (317 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At1g57870.1 68414.m06566 shaggy-related protein kinase kappa, pu... 33 0.041 At5g26751.1 68418.m03187 shaggy-related protein kinase alpha / A... 32 0.096 At3g05840.2 68416.m00656 shaggy-related protein kinase gamma / A... 32 0.096 At3g05840.1 68416.m00655 shaggy-related protein kinase gamma / A... 32 0.096 At4g00720.1 68417.m00098 shaggy-related protein kinase theta / A... 31 0.13 At1g09840.3 68414.m01108 shaggy-related protein kinase kappa / A... 31 0.13 At1g09840.2 68414.m01107 shaggy-related protein kinase kappa / A... 31 0.13 At1g09840.1 68414.m01106 shaggy-related protein kinase kappa / A... 31 0.13 At5g14640.1 68418.m01715 protein kinase family protein similar t... 29 0.89 At4g36820.1 68417.m05222 hypothetical protein contains Pfam doma... 28 1.2 At3g61160.2 68416.m06845 shaggy-related protein kinase beta / AS... 28 1.2 At3g61160.1 68416.m06844 shaggy-related protein kinase beta / AS... 28 1.2 At5g44290.1 68418.m05421 protein kinase family protein contains ... 28 1.6 At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest ... 28 1.6 At2g31850.1 68415.m03889 expressed protein 27 2.1 At1g10890.1 68414.m01251 F-box family protein contains Pfam PF00... 27 2.7 At4g18710.1 68417.m02766 shaggy-related protein kinase eta / ASK... 27 3.6 At3g28030.1 68416.m03499 UV hypersensitive protein (UVH3) / DNA-... 27 3.6 At2g10175.1 68415.m01058 hypothetical protein 27 3.6 At1g79930.1 68414.m09340 heat shock protein, putative contains P... 27 3.6 At5g19290.1 68418.m02299 esterase/lipase/thioesterase family pro... 26 4.8 At3g18310.1 68416.m02330 expressed protein 26 4.8 At2g48160.1 68415.m06031 PWWP domain-containing protein 26 4.8 At3g48750.1 68416.m05324 cell division control protein 2 homolog... 26 6.3 At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 ... 26 6.3 At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 ... 26 6.3 At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 ... 26 6.3 At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 ... 26 6.3 At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 ... 26 6.3 At1g54520.1 68414.m06218 expressed protein 26 6.3 At1g06390.2 68414.m00676 shaggy-related protein kinase iota / AS... 26 6.3 At1g06390.1 68414.m00675 shaggy-related protein kinase iota / AS... 26 6.3 At5g62290.1 68418.m07820 nucleotide-sensitive chloride conductan... 25 8.3 At2g27700.1 68415.m03356 eukaryotic translation initiation facto... 25 8.3 >At1g57870.1 68414.m06566 shaggy-related protein kinase kappa, putative / ASK-kappa, putative similar to shaggy-related protein kinase kappa SP:Q39019 GI:717180 from [Arabidopsis thaliana] Length = 420 Score = 33.1 bits (72), Expect = 0.041 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = +2 Query: 146 CYSICHKDNDPQENVINERTHLLEVTD 226 C +CH+D PQ ++N TH L++ D Sbjct: 200 CCGLCHRDIKPQNLLVNPHTHQLKICD 226 >At5g26751.1 68418.m03187 shaggy-related protein kinase alpha / ASK-alpha (ASK1) identical to shaggy-related protein kinase alpha SP:P43288 GI:460832 from [Arabidopsis thaliana] Length = 405 Score = 31.9 bits (69), Expect = 0.096 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 146 CYSICHKDNDPQENVINERTHLLEVTD 226 C +CH+D PQ ++N TH +++ D Sbjct: 187 CIGVCHRDIKPQNLLVNPHTHQVKLCD 213 >At3g05840.2 68416.m00656 shaggy-related protein kinase gamma / ASK-gamma (ASK3) identical to shaggy-related protein kinase gamma SP:P43289 GI:456509 from [Arabidopsis thaliana] Length = 409 Score = 31.9 bits (69), Expect = 0.096 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 146 CYSICHKDNDPQENVINERTHLLEVTD 226 C +CH+D PQ ++N TH +++ D Sbjct: 191 CIGVCHRDIKPQNLLVNPHTHQVKLCD 217 >At3g05840.1 68416.m00655 shaggy-related protein kinase gamma / ASK-gamma (ASK3) identical to shaggy-related protein kinase gamma SP:P43289 GI:456509 from [Arabidopsis thaliana] Length = 409 Score = 31.9 bits (69), Expect = 0.096 Identities = 10/27 (37%), Positives = 17/27 (62%) Frame = +2 Query: 146 CYSICHKDNDPQENVINERTHLLEVTD 226 C +CH+D PQ ++N TH +++ D Sbjct: 191 CIGVCHRDIKPQNLLVNPHTHQVKLCD 217 >At4g00720.1 68417.m00098 shaggy-related protein kinase theta / ASK-theta (ASK8) identical to shaggy-related protein kinase theta (ASK-theta) [Arabidopsis thaliana] SWISS-PROT:Q96287 Length = 472 Score = 31.5 bits (68), Expect = 0.13 Identities = 13/33 (39%), Positives = 21/33 (63%), Gaps = 1/33 (3%) Frame = +2 Query: 155 ICHKDNDPQENVINERTHLLEVTD-QQQETLVP 250 +CH+D PQ ++N +TH L++ D + LVP Sbjct: 259 VCHRDIKPQNLLVNPQTHQLKICDFGSAKMLVP 291 >At1g09840.3 68414.m01108 shaggy-related protein kinase kappa / ASK-kappa (ASK10) identical to shaggy-related protein kinase kappa SP:Q39019 GI:717180 from [Arabidopsis thaliana] Length = 421 Score = 31.5 bits (68), Expect = 0.13 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +2 Query: 149 YSICHKDNDPQENVINERTHLLEVTD 226 + +CH+D PQ ++N TH L++ D Sbjct: 202 FGLCHRDIKPQNLLVNPHTHQLKICD 227 >At1g09840.2 68414.m01107 shaggy-related protein kinase kappa / ASK-kappa (ASK10) identical to shaggy-related protein kinase kappa SP:Q39019 GI:717180 from [Arabidopsis thaliana] Length = 421 Score = 31.5 bits (68), Expect = 0.13 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +2 Query: 149 YSICHKDNDPQENVINERTHLLEVTD 226 + +CH+D PQ ++N TH L++ D Sbjct: 202 FGLCHRDIKPQNLLVNPHTHQLKICD 227 >At1g09840.1 68414.m01106 shaggy-related protein kinase kappa / ASK-kappa (ASK10) identical to shaggy-related protein kinase kappa SP:Q39019 GI:717180 from [Arabidopsis thaliana] Length = 421 Score = 31.5 bits (68), Expect = 0.13 Identities = 10/26 (38%), Positives = 17/26 (65%) Frame = +2 Query: 149 YSICHKDNDPQENVINERTHLLEVTD 226 + +CH+D PQ ++N TH L++ D Sbjct: 202 FGLCHRDIKPQNLLVNPHTHQLKICD 227 >At5g14640.1 68418.m01715 protein kinase family protein similar to glycogen synthase kinase-3 homolog MsK-3 SP:P51139 from [Medicago sativa]; contains Pfam profile PF00069: Protein kinase domain Length = 410 Score = 28.7 bits (61), Expect = 0.89 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 155 ICHKDNDPQENVINERTHLLEVTD 226 +CH+D PQ ++N TH +++ D Sbjct: 195 VCHRDIKPQNLLVNPHTHQVKLCD 218 >At4g36820.1 68417.m05222 hypothetical protein contains Pfam domain, PF04678: Protein of unknown function, DUF607 Length = 344 Score = 28.3 bits (60), Expect = 1.2 Identities = 15/47 (31%), Positives = 23/47 (48%), Gaps = 1/47 (2%) Frame = +2 Query: 110 CFNSLKTAVMGCC-YSICHKDNDPQENVINERTHLLEVTDQQQETLV 247 C + L ++ G S H NDP+ +NE + V DQ+ +LV Sbjct: 189 CVDQLTKSIEGLLPLSQIHNPNDPRRKELNELEAIKTVIDQKAHSLV 235 >At3g61160.2 68416.m06845 shaggy-related protein kinase beta / ASK-beta (ASK2) identical to shaggy-related protein kinase beta SP:O23145 GI:2569931 from [Arabidopsis thaliana] Length = 438 Score = 28.3 bits (60), Expect = 1.2 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 155 ICHKDNDPQENVINERTHLLEVTD 226 +CH+D PQ ++N TH +++ D Sbjct: 230 VCHRDIKPQNLLVNNVTHEVKICD 253 >At3g61160.1 68416.m06844 shaggy-related protein kinase beta / ASK-beta (ASK2) identical to shaggy-related protein kinase beta SP:O23145 GI:2569931 from [Arabidopsis thaliana] Length = 431 Score = 28.3 bits (60), Expect = 1.2 Identities = 9/24 (37%), Positives = 16/24 (66%) Frame = +2 Query: 155 ICHKDNDPQENVINERTHLLEVTD 226 +CH+D PQ ++N TH +++ D Sbjct: 223 VCHRDIKPQNLLVNNVTHEVKICD 246 >At5g44290.1 68418.m05421 protein kinase family protein contains Pfam domain, PF00069: Protein kinase domain Length = 644 Score = 27.9 bits (59), Expect = 1.6 Identities = 10/18 (55%), Positives = 16/18 (88%) Frame = +1 Query: 163 QRQRPTGERYKRKDTSTR 216 +RQRPT E+++R+D+ TR Sbjct: 451 KRQRPTQEKHERQDSQTR 468 >At4g35800.1 68417.m05087 DNA-directed RNA polymerase II largest subunit (RPB205) (RPII) (RPB1) nearly identical to P|P18616 DNA-directed RNA polymerase II largest subunit (EC 2.7.7.6) {Arabidopsis thaliana} Length = 1840 Score = 27.9 bits (59), Expect = 1.6 Identities = 22/69 (31%), Positives = 31/69 (44%) Frame = +2 Query: 14 GIPTIFSIFIHAKRSRYKTFMQSDDEDTSLHSCFNSLKTAVMGCCYSICHKDNDPQENVI 193 GIP I +FI K+ R F D+E S L T + +CH+D DP+ Sbjct: 1297 GIPDINKVFI--KQVRKSRF---DEEGGFKTSEEWMLDTEGVNLLAVMCHEDVDPKRTTS 1351 Query: 194 NERTHLLEV 220 N ++EV Sbjct: 1352 NHLIEIIEV 1360 >At2g31850.1 68415.m03889 expressed protein Length = 113 Score = 27.5 bits (58), Expect = 2.1 Identities = 13/34 (38%), Positives = 17/34 (50%) Frame = +1 Query: 208 STRSNGPATGDAGTCGSASTPPRKPDEQTALNRI 309 +TR NG DAG GS++ PD T N + Sbjct: 54 ATRLNGLRQDDAGLSGSSTGSCSSPDSSTGSNSV 87 >At1g10890.1 68414.m01251 F-box family protein contains Pfam PF00646: F-box domain; contains TIGRFAM TIGR01640 : F-box protein interaction domain Length = 592 Score = 27.1 bits (57), Expect = 2.7 Identities = 14/35 (40%), Positives = 21/35 (60%), Gaps = 1/35 (2%) Frame = +1 Query: 160 PQRQRPTGERYKRKDTSTRSNGPA-TGDAGTCGSA 261 P+R+ PT +RYKR+ + + + PA A T SA Sbjct: 21 PKRRSPTPKRYKRQKSRSSTPSPAKRSPAATLESA 55 >At4g18710.1 68417.m02766 shaggy-related protein kinase eta / ASK-eta (ASK7) identical to shaggy-related protein kinase eta (ASK-eta) [Arabidopsis thaliana] SWISS-PROT:Q39011 Length = 380 Score = 26.6 bits (56), Expect = 3.6 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +2 Query: 155 ICHKDNDPQENVINERTHLLEVTD 226 +CH+D PQ +++ TH +++ D Sbjct: 161 VCHRDLKPQNLLVDPLTHQVKICD 184 >At3g28030.1 68416.m03499 UV hypersensitive protein (UVH3) / DNA-repair protein, putative identical to UV hypersensitive protein [Arabidopsis thaliana] gi|13649704|gb|AAK37472; similar to Swiss-Prot:P14629 DNA-repair protein complementing XP-G cells homolog (Xeroderma pigmentosum group G complementing protein homolog) [Xenopus laevis] Length = 1479 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/29 (37%), Positives = 15/29 (51%) Frame = +2 Query: 152 SICHKDNDPQENVINERTHLLEVTDQQQE 238 S+ + DP NV+ R +L TD Q E Sbjct: 831 SLVTESRDPSRNVVRSRIGILHDTDSQNE 859 >At2g10175.1 68415.m01058 hypothetical protein Length = 122 Score = 26.6 bits (56), Expect = 3.6 Identities = 11/26 (42%), Positives = 15/26 (57%) Frame = +2 Query: 77 QSDDEDTSLHSCFNSLKTAVMGCCYS 154 Q D T LH+ ++SL T GC +S Sbjct: 18 QYDSLSTDLHTKYDSLSTGYFGCFWS 43 >At1g79930.1 68414.m09340 heat shock protein, putative contains Pfam profile: PF00012 Heat shock hsp70 proteins; similar to heat-shock proteins GB:CAA94389, GB:AAD55461 [Arabidopsis thaliana] Length = 831 Score = 26.6 bits (56), Expect = 3.6 Identities = 19/65 (29%), Positives = 27/65 (41%), Gaps = 3/65 (4%) Frame = +2 Query: 59 RYKTFMQSDDEDTSLHSCFNSLKTAVMGCCYSICHKDNDPQENVINERTHL---LEVTDQ 229 RYK ++ L C NS + A M H + ++ V+NE L Q Sbjct: 693 RYKESLERGSVIDQLGYCINSYREAAMSTDPKFDHIELAEKQKVLNECVEAEAWLRGKQQ 752 Query: 230 QQETL 244 QQ+TL Sbjct: 753 QQDTL 757 >At5g19290.1 68418.m02299 esterase/lipase/thioesterase family protein low similarity to monoglyceride lipase [Homo sapiens] GI:14594904; contains Interpro entry IPR000379 Length = 330 Score = 26.2 bits (55), Expect = 4.8 Identities = 9/31 (29%), Positives = 21/31 (67%) Frame = -3 Query: 129 VFKELKHECNEVSSSSDCINVLYRDLLAWIK 37 ++ EL H+ + S + ++++Y D+L+W+K Sbjct: 286 IYPELWHQM--IGESEEKVDLVYGDMLSWLK 314 >At3g18310.1 68416.m02330 expressed protein Length = 873 Score = 26.2 bits (55), Expect = 4.8 Identities = 8/10 (80%), Positives = 9/10 (90%) Frame = -1 Query: 182 PVGRCLCGKC 153 PVG+CLCG C Sbjct: 434 PVGKCLCGDC 443 >At2g48160.1 68415.m06031 PWWP domain-containing protein Length = 1366 Score = 26.2 bits (55), Expect = 4.8 Identities = 11/33 (33%), Positives = 17/33 (51%) Frame = +1 Query: 184 ERYKRKDTSTRSNGPATGDAGTCGSASTPPRKP 282 ERY++ R++ P + + GT GSA P Sbjct: 106 ERYEKLKQQERASDPKSAEEGTLGSAENTTLMP 138 >At3g48750.1 68416.m05324 cell division control protein 2 homolog A (CDC2A) identical to cell division control protein 2 homolog A [Arabidopsis thaliana] SWISS-PROT:P24100 Length = 294 Score = 25.8 bits (54), Expect = 6.3 Identities = 17/71 (23%), Positives = 30/71 (42%), Gaps = 4/71 (5%) Frame = +2 Query: 26 IFSIFIHAKRSRYKTFMQSDDEDTSLHSCFNSLKTAVMGCCYS----ICHKDNDPQENVI 193 ++ +F + K + D LH L + G Y + H+D PQ +I Sbjct: 76 LYLVFEYLDLDLKKHMDSTPDFSKDLHMIKTYLYQILRGIAYCHSHRVLHRDLKPQNLLI 135 Query: 194 NERTHLLEVTD 226 + RT+ L++ D Sbjct: 136 DRRTNSLKLAD 146 >At2g32700.5 68415.m04001 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 785 Score = 25.8 bits (54), Expect = 6.3 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 184 ERYKRKDTSTRSNGPA--TGDAGTCGSASTPPRKPDEQTALNRI 309 ++ RK S+GPA TG T G +++ P P T ++ + Sbjct: 371 QQNNRKRKGPSSSGPANSTGTGNTVGPSNSQPSTPSTHTPVDGV 414 >At2g32700.4 68415.m04000 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 25.8 bits (54), Expect = 6.3 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 184 ERYKRKDTSTRSNGPA--TGDAGTCGSASTPPRKPDEQTALNRI 309 ++ RK S+GPA TG T G +++ P P T ++ + Sbjct: 371 QQNNRKRKGPSSSGPANSTGTGNTVGPSNSQPSTPSTHTPVDGV 414 >At2g32700.3 68415.m03999 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 25.8 bits (54), Expect = 6.3 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 184 ERYKRKDTSTRSNGPA--TGDAGTCGSASTPPRKPDEQTALNRI 309 ++ RK S+GPA TG T G +++ P P T ++ + Sbjct: 371 QQNNRKRKGPSSSGPANSTGTGNTVGPSNSQPSTPSTHTPVDGV 414 >At2g32700.2 68415.m03998 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 25.8 bits (54), Expect = 6.3 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 184 ERYKRKDTSTRSNGPA--TGDAGTCGSASTPPRKPDEQTALNRI 309 ++ RK S+GPA TG T G +++ P P T ++ + Sbjct: 371 QQNNRKRKGPSSSGPANSTGTGNTVGPSNSQPSTPSTHTPVDGV 414 >At2g32700.1 68415.m03997 WD-40 repeat family protein contains 7 WD-40 repeats ; similar to LEUNIG (GP:11141605)[Arabidopsis thaliana] Length = 787 Score = 25.8 bits (54), Expect = 6.3 Identities = 13/44 (29%), Positives = 22/44 (50%), Gaps = 2/44 (4%) Frame = +1 Query: 184 ERYKRKDTSTRSNGPA--TGDAGTCGSASTPPRKPDEQTALNRI 309 ++ RK S+GPA TG T G +++ P P T ++ + Sbjct: 371 QQNNRKRKGPSSSGPANSTGTGNTVGPSNSQPSTPSTHTPVDGV 414 >At1g54520.1 68414.m06218 expressed protein Length = 391 Score = 25.8 bits (54), Expect = 6.3 Identities = 11/21 (52%), Positives = 13/21 (61%) Frame = +2 Query: 212 LEVTDQQQETLVPVDQRPHHR 274 LE+T Q +P QRPHHR Sbjct: 8 LELTPFQWNQPLPYTQRPHHR 28 >At1g06390.2 68414.m00676 shaggy-related protein kinase iota / ASK-iota (ASK9) (GSK1) identical to shaggy-related protein kinase iota (ASK-iota) [Arabidopsis thaliana] SWISS-PROT:Q39012 Length = 407 Score = 25.8 bits (54), Expect = 6.3 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +2 Query: 155 ICHKDNDPQENVINERTHLLEVTD 226 +CH+D PQ +++ TH +++ D Sbjct: 191 VCHRDVKPQNLLVDPLTHQVKLCD 214 >At1g06390.1 68414.m00675 shaggy-related protein kinase iota / ASK-iota (ASK9) (GSK1) identical to shaggy-related protein kinase iota (ASK-iota) [Arabidopsis thaliana] SWISS-PROT:Q39012 Length = 407 Score = 25.8 bits (54), Expect = 6.3 Identities = 8/24 (33%), Positives = 16/24 (66%) Frame = +2 Query: 155 ICHKDNDPQENVINERTHLLEVTD 226 +CH+D PQ +++ TH +++ D Sbjct: 191 VCHRDVKPQNLLVDPLTHQVKLCD 214 >At5g62290.1 68418.m07820 nucleotide-sensitive chloride conductance regulator (ICln) family protein contains PF03517: Nucleotide-sensitive chloride conductance regulator (ICln) Length = 229 Score = 25.4 bits (53), Expect = 8.3 Identities = 13/53 (24%), Positives = 25/53 (47%) Frame = +2 Query: 98 SLHSCFNSLKTAVMGCCYSICHKDNDPQENVINERTHLLEVTDQQQETLVPVD 256 SLH+ + C Y+ + D + +E T +L+++ ++ LVP D Sbjct: 78 SLHAVSRDPEAYSSPCIYTQIEVEEDEDDESDSESTEVLDLSKIREMRLVPSD 130 >At2g27700.1 68415.m03356 eukaryotic translation initiation factor 2 family protein / eIF-2 family protein similar to SP|P39730 Translation initiation factor IF-2 {Saccharomyces cerevisiae}; contains Pfam profiles PF00009: Elongation factor Tu GTP binding domain, PF03144: Elongation factor Tu domain 2 Length = 479 Score = 25.4 bits (53), Expect = 8.3 Identities = 11/35 (31%), Positives = 20/35 (57%) Frame = -3 Query: 156 ML*QQPITAVFKELKHECNEVSSSSDCINVLYRDL 52 +L PI + H +EV +++CIN++ +DL Sbjct: 307 LLTPHPIKELHVNGNHVHHEVIKAAECINIIAKDL 341 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 6,727,149 Number of Sequences: 28952 Number of extensions: 120003 Number of successful extensions: 434 Number of sequences better than 10.0: 34 Number of HSP's better than 10.0 without gapping: 428 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 434 length of database: 12,070,560 effective HSP length: 71 effective length of database: 10,014,968 effective search space used: 340508912 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -