BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00250 (513 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At3g60800.1 68416.m06801 zinc finger (DHHC type) family protein ... 66 1e-11 At4g22750.1 68417.m03283 zinc finger (DHHC type) family protein ... 65 2e-11 At4g00840.1 68417.m00115 zinc finger (DHHC type) family protein ... 62 2e-10 At3g09320.1 68416.m01106 zinc finger (DHHC type) family protein ... 59 2e-09 At3g26935.1 68416.m03371 zinc finger (DHHC type) family protein ... 58 3e-09 At5g41060.1 68418.m04991 zinc finger (DHHC type) family protein ... 56 1e-08 At5g04270.1 68418.m00419 zinc finger (DHHC type) family protein ... 54 4e-08 At3g48760.1 68416.m05325 zinc finger (DHHC type) family protein ... 53 1e-07 At3g56920.1 68416.m06331 zinc finger (DHHC type) family protein ... 52 2e-07 At4g24630.1 68417.m03527 zinc finger (DHHC type) family protein ... 52 3e-07 At3g56930.1 68416.m06332 zinc finger (DHHC type) family protein ... 52 3e-07 At2g40990.1 68415.m05063 zinc finger (DHHC type) family protein ... 51 4e-07 At3g04970.2 68416.m00539 zinc finger (DHHC type) family protein ... 48 5e-06 At3g04970.1 68416.m00540 zinc finger (DHHC type) family protein ... 48 5e-06 At3g18620.1 68416.m02366 zinc finger (DHHC type) family protein ... 47 6e-06 At4g01730.1 68417.m00224 zinc finger (DHHC type) family protein ... 47 9e-06 At4g15080.1 68417.m02317 zinc finger (DHHC type) family protein ... 46 2e-05 At2g14255.1 68415.m01593 zinc finger (DHHC type) family protein ... 43 1e-04 At5g50020.1 68418.m06195 zinc finger (DHHC type) family protein ... 42 2e-04 At3g22180.1 68416.m02799 zinc finger (DHHC type) family protein ... 42 2e-04 At1g69420.2 68414.m07975 zinc finger (DHHC type) family protein ... 40 0.001 At1g69420.1 68414.m07974 zinc finger (DHHC type) family protein ... 40 0.001 At5g20350.1 68418.m02421 zinc finger (DHHC type) family protein ... 38 0.003 At2g33640.1 68415.m04124 zinc finger (DHHC type) family protein ... 38 0.005 At5g05070.1 68418.m00538 zinc finger (DHHC type) family protein ... 33 0.085 At3g51390.1 68416.m05629 zinc finger (DHHC type) family protein ... 33 0.085 At4g33200.1 68417.m04727 myosin, putative similar to myosin (GI:... 32 0.26 At1g13210.1 68414.m01532 haloacid dehalogenase-like hydrolase fa... 31 0.34 At4g31630.1 68417.m04493 transcriptional factor B3 family protei... 29 2.4 At4g30560.1 68417.m04337 cyclic nucleotide-regulated ion channel... 27 5.6 At4g29200.1 68417.m04177 hypothetical protein 27 5.6 At3g20380.1 68416.m02582 meprin and TRAF homology domain-contain... 27 5.6 At1g68710.1 68414.m07850 haloacid dehalogenase-like hydrolase fa... 27 7.4 At3g57630.2 68416.m06421 exostosin family protein contains Pfam ... 27 9.8 At3g57630.1 68416.m06420 exostosin family protein contains Pfam ... 27 9.8 >At3g60800.1 68416.m06801 zinc finger (DHHC type) family protein contains DHHC zinc finger domain PF01529 Length = 307 Score = 66.1 bits (154), Expect = 1e-11 Identities = 32/77 (41%), Positives = 42/77 (54%) Frame = +1 Query: 1 LKMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRLWKGDFGTATSSGR 180 LKMDHHC WV NCV NYK+F+LFL Y L V +P+FI + + T Sbjct: 151 LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLVLMPHFIAFFSDEEIPGTPGTL 210 Query: 181 YHIIFAFFVSLMFAISL 231 AF ++L FA+S+ Sbjct: 211 ATTFLAFVLNLAFALSV 227 Score = 43.2 bits (97), Expect = 1e-04 Identities = 29/87 (33%), Positives = 43/87 (49%) Frame = +3 Query: 225 ISGFTIRIPLYLVVNNRTTLEAFRAPMFRGGADKNGFSIGAFKNFKEVFGNSPNLWLVPV 404 + GF I + + LV N TT+EA+ + K + +G KNF++VFG WL+P Sbjct: 227 VMGFLI-MHISLVAGNTTTIEAYE----KKTTTKWRYDLGKKKNFEQVFGMDKRYWLIPG 281 Query: 405 FTSLGDGCEYPVRREHQLQTFTSPQDP 485 +T E +RR +LQ P P Sbjct: 282 YT------EEDLRRMPELQGLEYPSKP 302 >At4g22750.1 68417.m03283 zinc finger (DHHC type) family protein contains DHHC zinc finger domain PF01529 Length = 302 Score = 65.3 bits (152), Expect = 2e-11 Identities = 35/79 (44%), Positives = 45/79 (56%), Gaps = 2/79 (2%) Frame = +1 Query: 1 LKMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRLWK-GDFGTATSSG 177 LKMDHHC WV NCV +NYK F+LFL Y L V + LP F+ + GD S G Sbjct: 140 LKMDHHCVWVVNCVGANNYKSFLLFLFYTFLETTVVAVSLLPIFLVFFSDGDGDITVSPG 199 Query: 178 RYHIIF-AFFVSLMFAISL 231 F AF +++ FA+S+ Sbjct: 200 SLAASFVAFVLNIAFALSV 218 Score = 38.7 bits (86), Expect = 0.002 Identities = 26/95 (27%), Positives = 44/95 (46%) Frame = +3 Query: 126 VFHTTLEGRLRYSDIEWSLSHHIRFFRVANVRDISGFTIRIPLYLVVNNRTTLEAFRAPM 305 VF + +G + S + S +A + GF I + + LV N TT+EA+ Sbjct: 185 VFFSDGDGDITVSPGSLAASFVAFVLNIAFALSVLGFLI-MHIMLVARNTTTIEAYEKHT 243 Query: 306 FRGGADKNGFSIGAFKNFKEVFGNSPNLWLVPVFT 410 +++G NF++VFG+ W VP++T Sbjct: 244 VNWP-----YNVGRKTNFEQVFGSDKMYWFVPLYT 273 >At4g00840.1 68417.m00115 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 262 Score = 62.1 bits (144), Expect = 2e-10 Identities = 29/68 (42%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +1 Query: 1 LKMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRLWKGDFGTATSSGR 180 LKMDHHC W+ NCV NYKFF+LFL Y L + + LP FI + ++S G+ Sbjct: 80 LKMDHHCVWIVNCVGARNYKFFLLFLFYTFLETMLDVIVLLPSFIEFFSQAIKHSSSPGK 139 Query: 181 Y-HIIFAF 201 ++ AF Sbjct: 140 LASLVLAF 147 >At3g09320.1 68416.m01106 zinc finger (DHHC type) family protein similar to Golgi-specific DHHC zinc figer protein [Mus musculus] GI:21728103; contains Pfam profile PF01529: DHHC zinc finger domain Length = 286 Score = 59.3 bits (137), Expect = 2e-09 Identities = 28/84 (33%), Positives = 46/84 (54%) Frame = +1 Query: 1 LKMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRLWKGDFGTATSSGR 180 L+MDHHC W+NNCV NYK F +F+ YA+ C++ + + + + S R Sbjct: 121 LRMDHHCIWINNCVGHTNYKVFFVFVVYAVTACVYSLVLLVGSLTVEPQDEEEEMGSYLR 180 Query: 181 YHIIFAFFVSLMFAISLGSLFGYH 252 + + F+ + +I+LG L G+H Sbjct: 181 TIYVISAFLLIPLSIALGVLLGWH 204 Score = 35.9 bits (79), Expect = 0.016 Identities = 19/67 (28%), Positives = 32/67 (47%), Gaps = 6/67 (8%) Frame = +3 Query: 252 LYLVVNNRTTLEAFRAPMFRGGADKNG------FSIGAFKNFKEVFGNSPNLWLVPVFTS 413 +YL++ N+TT+E A+K G + IGA++N + G + WL P Sbjct: 205 IYLILQNKTTIEYHEGVRAMWLAEKGGQVYKHPYDIGAYENLTLILGPNILSWLCPTSRH 264 Query: 414 LGDGCEY 434 +G G + Sbjct: 265 IGSGVRF 271 >At3g26935.1 68416.m03371 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 443 Score = 58.4 bits (135), Expect = 3e-09 Identities = 32/109 (29%), Positives = 52/109 (47%), Gaps = 9/109 (8%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRLWKGDFGTA-----T 168 + DHHCPWV C+ NY+FF +F+ L C++V A C Y ++ + + T Sbjct: 174 RFDHHCPWVGQCIGMRNYRFFFMFVFSTTLLCIYVFAFCWVYIRKIMESEHTTTWKAMLK 233 Query: 169 SSGRYHIIFAFFVSLMFAISLGSLFGYH----CTSSSIIEQL*KRLERR 303 + +I F+S+ F +G L +H T+ + E R +RR Sbjct: 234 TPASIVLIIYTFISMWF---VGGLTVFHLYLISTNQTTYENFRYRYDRR 279 Score = 32.3 bits (70), Expect = 0.20 Identities = 19/49 (38%), Positives = 25/49 (51%) Frame = +3 Query: 225 ISGFTIRIPLYLVVNNRTTLEAFRAPMFRGGADKNGFSIGAFKNFKEVF 371 + G T+ LYL+ N+TT E FR +R N + G NFKE F Sbjct: 251 VGGLTV-FHLYLISTNQTTYENFR---YRYDRRSNPHNKGVVNNFKETF 295 >At5g41060.1 68418.m04991 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 410 Score = 56.4 bits (130), Expect = 1e-08 Identities = 19/46 (41%), Positives = 28/46 (60%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRL 141 + DHHCPWV C+ NY+FF +F+ L C++V A C Y ++ Sbjct: 172 RFDHHCPWVGQCIAQRNYRFFFMFVFSTTLLCVYVFAFCCVYIKKI 217 Score = 29.9 bits (64), Expect = 1.1 Identities = 17/40 (42%), Positives = 21/40 (52%) Frame = +3 Query: 252 LYLVVNNRTTLEAFRAPMFRGGADKNGFSIGAFKNFKEVF 371 LYL+ N+TT E FR R N + G NFKE+F Sbjct: 257 LYLISTNQTTYENFRYSYDR---HSNPHNKGVVDNFKEIF 293 >At5g04270.1 68418.m00419 zinc finger (DHHC type) family protein low similarity to Golgi-specific DHHC zinc figer protein [Mus musculus] GI:21728103; contains Pfam profile PF01529: DHHC zinc finger domain Length = 284 Score = 54.4 bits (125), Expect = 4e-08 Identities = 28/84 (33%), Positives = 43/84 (51%) Frame = +1 Query: 1 LKMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRLWKGDFGTATSSGR 180 LKMDHHC W+NNCV + NYK F + + YA + ++ +T L GD + Sbjct: 129 LKMDHHCLWINNCVGYANYKAFFILVFYATVASIY--STVLLVCCAFKNGDSYAGNVPLK 186 Query: 181 YHIIFAFFVSLMFAISLGSLFGYH 252 I+ + +I+LG+L +H Sbjct: 187 TFIVSCGIFMIGLSITLGTLLCWH 210 Score = 38.3 bits (85), Expect = 0.003 Identities = 23/73 (31%), Positives = 36/73 (49%), Gaps = 7/73 (9%) Frame = +3 Query: 252 LYLVVNNRTTLEAFRAPMFRGGADKNG------FSIGAFKNFKEVFGNSPNLWLVPVFT- 410 +YL+ +N TT+E + + A K+G F +G +KN V G + WL P FT Sbjct: 211 IYLITHNMTTIEHYDSKRASWLARKSGQSYRHQFDVGFYKNLTSVLGPNMIKWLCPTFTR 270 Query: 411 SLGDGCEYPVRRE 449 + DG + R+ Sbjct: 271 NPEDGISFSASRD 283 >At3g48760.1 68416.m05325 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 476 Score = 53.2 bits (122), Expect = 1e-07 Identities = 18/46 (39%), Positives = 28/46 (60%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRL 141 K DHHCPW+ C+ NY+F+ +F+ + L C++V C Y R+ Sbjct: 183 KFDHHCPWLGQCIGLRNYRFYFMFVLCSTLLCIYVHVFCWIYVKRI 228 >At3g56920.1 68416.m06331 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 338 Score = 52.4 bits (120), Expect = 2e-07 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFV 108 + DHHCPWV C+ NY FF+ FL + L C++V Sbjct: 167 RFDHHCPWVGQCIALRNYPFFVCFLSCSTLLCIYV 201 Score = 31.5 bits (68), Expect = 0.34 Identities = 17/49 (34%), Positives = 26/49 (53%) Frame = +3 Query: 225 ISGFTIRIPLYLVVNNRTTLEAFRAPMFRGGADKNGFSIGAFKNFKEVF 371 + G T+ YL+ N+TT E FR + +N + G +NFKE+F Sbjct: 240 VGGLTV-FHFYLICTNQTTCENFR---YHYDKKENPYRKGILENFKELF 284 >At4g24630.1 68417.m03527 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 374 Score = 51.6 bits (118), Expect = 3e-07 Identities = 15/42 (35%), Positives = 26/42 (61%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPY 129 + DHHCPWV C+ NY++F +F+ + L C+++ + Y Sbjct: 161 RFDHHCPWVGQCIGLRNYRYFFMFVSSSTLLCIYIFSMSAVY 202 >At3g56930.1 68416.m06332 zinc finger (DHHC type) family protein low similarity to Golgi-specific DHHC zinc figer protein [Mus musculus] GI:21728103; contains Pfam profile PF01529: DHHC zinc finger domain Length = 477 Score = 51.6 bits (118), Expect = 3e-07 Identities = 16/37 (43%), Positives = 24/37 (64%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMA 114 + DHHCPWV C+ NY+FF +F+ + C++V A Sbjct: 171 RFDHHCPWVGQCIGVRNYRFFFMFISTSTTLCIYVFA 207 Score = 27.9 bits (59), Expect = 4.2 Identities = 17/49 (34%), Positives = 25/49 (51%) Frame = +3 Query: 225 ISGFTIRIPLYLVVNNRTTLEAFRAPMFRGGADKNGFSIGAFKNFKEVF 371 + G TI YL+ N+TT E FR +R +N ++ G N E+F Sbjct: 248 VGGLTI-FHSYLICTNQTTYENFR---YRYDKKENPYNKGILGNIWEIF 292 >At2g40990.1 68415.m05063 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 386 Score = 51.2 bits (117), Expect = 4e-07 Identities = 16/35 (45%), Positives = 23/35 (65%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFV 108 + DHHCPWV C+ NY +F+ F+ + L CL+V Sbjct: 160 RFDHHCPWVGQCIALRNYPYFICFISTSTLLCLYV 194 Score = 34.3 bits (75), Expect = 0.049 Identities = 19/49 (38%), Positives = 27/49 (55%) Frame = +3 Query: 225 ISGFTIRIPLYLVVNNRTTLEAFRAPMFRGGADKNGFSIGAFKNFKEVF 371 + G T+ LYL+ N+TT E FR +R +N + G FKN E+F Sbjct: 234 VGGLTV-FHLYLICTNQTTYENFR---YRYDKKENPYGKGLFKNLYELF 278 >At3g04970.2 68416.m00539 zinc finger (DHHC type) family protein similar to Golgi-specific DHHC zinc figer protein [Mus musculus] GI:21728103; contains Pfam profile PF01529: DHHC zinc finger domain Length = 316 Score = 47.6 bits (108), Expect = 5e-06 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLF 105 + DHHC W+NNC+ N K+FM FL + L CL+ Sbjct: 185 RFDHHCGWMNNCIGERNTKYFMAFLLWHFLLCLY 218 >At3g04970.1 68416.m00540 zinc finger (DHHC type) family protein similar to Golgi-specific DHHC zinc figer protein [Mus musculus] GI:21728103; contains Pfam profile PF01529: DHHC zinc finger domain Length = 397 Score = 47.6 bits (108), Expect = 5e-06 Identities = 17/34 (50%), Positives = 23/34 (67%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLF 105 + DHHC W+NNC+ N K+FM FL + L CL+ Sbjct: 185 RFDHHCGWMNNCIGERNTKYFMAFLLWHFLLCLY 218 >At3g18620.1 68416.m02366 zinc finger (DHHC type) family protein contains Pfam profile: PF01529 DHHC zinc finger domain Length = 345 Score = 47.2 bits (107), Expect = 6e-06 Identities = 23/73 (31%), Positives = 39/73 (53%), Gaps = 1/73 (1%) Frame = +1 Query: 1 LKMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRLWKG-DFGTATSSG 177 L MDHHCP++ NCV N+K+F+ FL A++ + C+ I + + G A +S Sbjct: 172 LDMDHHCPFIGNCVGAGNHKYFIAFLISAVISTSYAAVMCVYTLIHILPPIEKGAAYASD 231 Query: 178 RYHIIFAFFVSLM 216 H+ +S++ Sbjct: 232 VAHVAHGNSISIL 244 >At4g01730.1 68417.m00224 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 499 Score = 46.8 bits (106), Expect = 9e-06 Identities = 19/43 (44%), Positives = 25/43 (58%) Frame = +1 Query: 10 DHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIR 138 DHHC W+NNCV NY F+L + + LL + T L F+R Sbjct: 176 DHHCRWLNNCVGKKNYTTFILLMVFVLLMLIIEGGTALAVFVR 218 >At4g15080.1 68417.m02317 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 718 Score = 45.6 bits (103), Expect = 2e-05 Identities = 28/84 (33%), Positives = 41/84 (48%), Gaps = 6/84 (7%) Frame = +1 Query: 10 DHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRLW--KGDFGT----ATS 171 DHHC W+NNCV NY F+ + +LL+ L + +R++ K D T Sbjct: 201 DHHCRWLNNCVGRKNYMTFISLMAVSLLWLLIEAGVGIAVIVRVFVNKKDMETEIVNRLG 260 Query: 172 SGRYHIIFAFFVSLMFAISLGSLF 243 +G FA V L A+S+ +LF Sbjct: 261 NGFSRAPFATVVGLCTAVSMLALF 284 >At2g14255.1 68415.m01593 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain; low similarity to SP:Q96GR4 Zinc finger DHHC domain containing protein 12 (Zinc finger protein 400) {Homo sapiens} Length = 288 Score = 43.2 bits (97), Expect = 1e-04 Identities = 18/49 (36%), Positives = 28/49 (57%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRLWKG 150 + DHHCPW++NCV N ++F++F+ L T + RLW+G Sbjct: 140 QFDHHCPWISNCVGKKNKRYFLVFVIMGALTSFVGGTTAVQ---RLWRG 185 >At5g50020.1 68418.m06195 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 407 Score = 42.3 bits (95), Expect = 2e-04 Identities = 25/88 (28%), Positives = 41/88 (46%), Gaps = 5/88 (5%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRLWKGDFGTATSSGR- 180 + DHHCPW NY++F +F+ A + C+++ + Y L GT + R Sbjct: 161 RFDHHCPW-------RNYRYFFMFVSSATILCIYIFSMSALYIKVLMDNHQGTVWRAMRE 213 Query: 181 ----YHIIFAFFVSLMFAISLGSLFGYH 252 ++ F+SL F +G L G+H Sbjct: 214 SPWAVMLMIYCFISLWF---VGGLTGFH 238 Score = 27.9 bits (59), Expect = 4.2 Identities = 16/40 (40%), Positives = 21/40 (52%) Frame = +3 Query: 252 LYLVVNNRTTLEAFRAPMFRGGADKNGFSIGAFKNFKEVF 371 LYL+ N+TT E FR +R N ++ G NF E F Sbjct: 239 LYLISTNQTTYENFR---YRSDNRINVYNRGCSNNFFETF 275 >At3g22180.1 68416.m02799 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 706 Score = 41.9 bits (94), Expect = 2e-04 Identities = 16/45 (35%), Positives = 26/45 (57%) Frame = +1 Query: 10 DHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRLW 144 DHHC W+NNCV NY F+ + +LL+ + A + +R++ Sbjct: 199 DHHCKWLNNCVGRKNYVTFVSLMSASLLWLIIEAAVGIAVIVRVF 243 >At1g69420.2 68414.m07975 zinc finger (DHHC type) family protein contains Pfam profile: PF01529: DHHC zinc finger domain Length = 596 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 7/47 (14%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNY-KFFMLFLGYALLYC------LFVMATCL 123 + DHHC W+NNC+ NY KFF L + L +FV+ CL Sbjct: 188 RFDHHCRWLNNCIGKRNYRKFFSLMVSAIFLLIMQWSTGIFVLVLCL 234 >At1g69420.1 68414.m07974 zinc finger (DHHC type) family protein contains Pfam profile: PF01529: DHHC zinc finger domain Length = 596 Score = 39.5 bits (88), Expect = 0.001 Identities = 19/47 (40%), Positives = 25/47 (53%), Gaps = 7/47 (14%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNY-KFFMLFLGYALLYC------LFVMATCL 123 + DHHC W+NNC+ NY KFF L + L +FV+ CL Sbjct: 188 RFDHHCRWLNNCIGKRNYRKFFSLMVSAIFLLIMQWSTGIFVLVLCL 234 >At5g20350.1 68418.m02421 zinc finger (DHHC type) family protein / ankyrin repeat family protein similar to patsas protein [Drosophila melanogaster] GI:6002770; contains Pfam profiles PF00023: Ankyrin repeat, PF01529: DHHC zinc finger domain Length = 592 Score = 38.3 bits (85), Expect = 0.003 Identities = 15/25 (60%), Positives = 17/25 (68%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFFMLFL 78 + DHHCPWV+NCV N F LFL Sbjct: 368 QFDHHCPWVSNCVGKKNKWEFFLFL 392 >At2g33640.1 68415.m04124 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 565 Score = 37.5 bits (83), Expect = 0.005 Identities = 14/43 (32%), Positives = 22/43 (51%) Frame = +1 Query: 10 DHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIR 138 DHHC W+NNCV NY F+ + + + + + F+R Sbjct: 171 DHHCRWLNNCVGQKNYISFVCLMAASFFWLIAEFGVGVTVFVR 213 >At5g05070.1 68418.m00538 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 339 Score = 33.5 bits (73), Expect = 0.085 Identities = 10/21 (47%), Positives = 13/21 (61%) Frame = +1 Query: 4 KMDHHCPWVNNCVCFHNYKFF 66 + DHHCPWV C+ Y+ F Sbjct: 196 RFDHHCPWVGQCIARTTYENF 216 >At3g51390.1 68416.m05629 zinc finger (DHHC type) family protein contains Pfam profile PF01529: DHHC zinc finger domain Length = 340 Score = 33.5 bits (73), Expect = 0.085 Identities = 12/49 (24%), Positives = 23/49 (46%) Frame = +1 Query: 1 LKMDHHCPWVNNCVCFHNYKFFMLFLGYALLYCLFVMATCLPYFIRLWK 147 L+ DHHC W+ C+ N+ F ++ C++ + + Y + K Sbjct: 186 LQFDHHCVWLGTCIGQKNHSKFWWYICEETTLCIWTLIMYVDYLSNVAK 234 >At4g33200.1 68417.m04727 myosin, putative similar to myosin (GI:433663) [Arabidopsis thaliana] Length = 1522 Score = 31.9 bits (69), Expect = 0.26 Identities = 21/65 (32%), Positives = 32/65 (49%), Gaps = 4/65 (6%) Frame = +2 Query: 326 KWLLNWCFQKLQGSVR**SE----PLVGACIHKPRRRLRISGTSRTPAADVHEPPGPMAT 493 K L C +K+ G +R + PL+G+CI P+ I+G SR+P + P + Sbjct: 1247 KQQLTACVEKIYGLIRDNLKKELSPLLGSCIQAPKASRGIAGKSRSPGGVPQQSP----S 1302 Query: 494 SPWAS 508 S W S Sbjct: 1303 SQWES 1307 >At1g13210.1 68414.m01532 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) (Chromaffin granule ATPase) from {Homo sapiens} SP|Q9Y2Q0, {Mus musculus} SP|P98200, {Bos taurus} SP|Q29449; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase; ESTs gb|T45045 and gb|AA394473 come from this gene Length = 1203 Score = 31.5 bits (68), Expect = 0.34 Identities = 19/66 (28%), Positives = 28/66 (42%), Gaps = 2/66 (3%) Frame = +3 Query: 315 GADKNGFSIGAFKNFKEVFGNSPNLWLVPVFTSLGDGCEYPVRREHQLQTFTSPQD--PW 488 GA FS A+K F E +P+ WL +F + V + Q++ F W Sbjct: 1091 GAITPSFSTDAYKVFIEALAPAPSYWLTTLFVMFFALIPFFVFKSVQMRFFPGYHQMIQW 1150 Query: 489 LRVHGH 506 +R GH Sbjct: 1151 IRYEGH 1156 >At4g31630.1 68417.m04493 transcriptional factor B3 family protein similar to reproductive meristem gene 1 from [Brassica oleracea var. botrytis] GI:3170424, [Arabidopsis thaliana] GI:13604227; contains Pfam profile PF02362: B3 DNA binding domain Length = 512 Score = 28.7 bits (61), Expect = 2.4 Identities = 20/68 (29%), Positives = 32/68 (47%), Gaps = 1/68 (1%) Frame = +3 Query: 258 LVVNNRTTLEAFRAPMFRGGADKNGFSIGAFKNFKEV-FGNSPNLWLVPVFTSLGDGCEY 434 L+ +N+ T +AF +R NG G+ FK V G P L L P +S+ +G Sbjct: 216 LLRHNKKTGQAFMRGGWRSFCRNNGIKAGSICRFKLVQSGIKPVLQLCPNASSIPEGNSS 275 Query: 435 PVRREHQL 458 R++ + Sbjct: 276 KARKKRNV 283 >At4g30560.1 68417.m04337 cyclic nucleotide-regulated ion channel, putative similar to cyclic nucleotide and calmodulin-regulated ion channel cngc6 GI:4581207 from [Arabidopsis thaliana] Length = 733 Score = 27.5 bits (58), Expect = 5.6 Identities = 24/75 (32%), Positives = 31/75 (41%), Gaps = 1/75 (1%) Frame = +3 Query: 270 NRTTLEAFRAPMFRGGADKNGFSIGAFKNFKEVFGNSPNLWLVPVFTSLG-DGCEYPVRR 446 NR TL + P GGA N S G+FK K S LW + LG +P Sbjct: 40 NRCTLN-LQGPTRGGGAQGNNVSSGSFK--KGFRKGSKGLWSIGRSIGLGVSRAVFPEDL 96 Query: 447 EHQLQTFTSPQDPWL 491 + + PQD +L Sbjct: 97 KVSEKKIFDPQDKFL 111 >At4g29200.1 68417.m04177 hypothetical protein Length = 457 Score = 27.5 bits (58), Expect = 5.6 Identities = 10/24 (41%), Positives = 15/24 (62%) Frame = +3 Query: 69 AVPWLRAAVLSLCHGDMPAVFHTT 140 A PW+ A LS H +P +FH++ Sbjct: 125 ATPWIFATYLSHGHSLLPTIFHSS 148 >At3g20380.1 68416.m02582 meprin and TRAF homology domain-containing protein / MATH domain-containing protein weak similarity to ubiquitin-specific protease 12 [Arabidopsis thaliana] GI:11993471; contains Pfam profile PF00917: MATH domain Length = 375 Score = 27.5 bits (58), Expect = 5.6 Identities = 11/25 (44%), Positives = 16/25 (64%) Frame = +1 Query: 88 LLYCLFVMATCLPYFIRLWKGDFGT 162 LL+CLF+ ++ FIR + DF T Sbjct: 14 LLFCLFITSSSAGSFIRQFSDDFNT 38 >At1g68710.1 68414.m07850 haloacid dehalogenase-like hydrolase family protein similar to Potential phospholipid-transporting ATPase (EC 3.6.3.1) from {Mus musculus} SP|P98200, {Bos taurus} SP|Q29449, {Homo sapiens} SP|O43520; contains InterPro accession IPR005834: Haloacid dehalogenase-like hydrolase Length = 1200 Score = 27.1 bits (57), Expect = 7.4 Identities = 17/58 (29%), Positives = 24/58 (41%), Gaps = 2/58 (3%) Frame = +3 Query: 336 SIGAFKNFKEVFGNSPNLWLVPVFTSLGDGCEYPVRREHQLQTFTSPQD--PWLRVHG 503 S GA+K F E S + WL+ +F + Y + Q+ F WLR G Sbjct: 1102 STGAYKVFVEALAPSLSYWLITLFVVVATLMPYFIYSALQMSFFPMYHGMIQWLRYEG 1159 >At3g57630.2 68416.m06421 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 791 Score = 26.6 bits (56), Expect = 9.8 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +3 Query: 300 PMFRGGADKNGFSIGAFKNFKEVFGNSPN 386 P + G ++ +S+G + E FG+SPN Sbjct: 575 PAYEKGRPEDSYSMGIRQKLAEEFGSSPN 603 >At3g57630.1 68416.m06420 exostosin family protein contains Pfam profile: PF03016 exostosin family Length = 793 Score = 26.6 bits (56), Expect = 9.8 Identities = 10/29 (34%), Positives = 17/29 (58%) Frame = +3 Query: 300 PMFRGGADKNGFSIGAFKNFKEVFGNSPN 386 P + G ++ +S+G + E FG+SPN Sbjct: 577 PAYEKGRPEDSYSMGIRQKLAEEFGSSPN 605 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 12,064,165 Number of Sequences: 28952 Number of extensions: 262857 Number of successful extensions: 820 Number of sequences better than 10.0: 35 Number of HSP's better than 10.0 without gapping: 757 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 817 length of database: 12,070,560 effective HSP length: 76 effective length of database: 9,870,208 effective search space used: 927799552 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -