Bombyx BLAST Result against arabidopsis

BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00248
         (771 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At3g14070.1 68416.m01777 cation exchanger, putative (CAX9) simil...    29   4.5  

>At3g14070.1 68416.m01777 cation exchanger, putative (CAX9) similar
           to sodium/calcium exchanger protein [Mus musculus]
           gi|13925661|gb|AAK49407; Ca2+:Cation Antiporter (CaCA)
           Family member PMID:11500563
          Length = 643

 Score = 28.7 bits (61), Expect = 4.5
 Identities = 17/62 (27%), Positives = 29/62 (46%)
 Frame = +1

Query: 115 CTAILNCCFLSWTSFRRRCLMRPLPSIS*NNGSTILTVSWGFMTENLRARHLHTTGHGPS 294
           C  +L C F   +   R  L+R    ++  +GST   ++  FM     AR + T G G +
Sbjct: 23  CALVLFCFFFDRSELLRNPLLRNASFVNGGSGSTSGGIT-QFMVIRRNARQIETNGSGNN 81

Query: 295 AT 300
           ++
Sbjct: 82  SS 83


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 15,669,606
Number of Sequences: 28952
Number of extensions: 309306
Number of successful extensions: 722
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 706
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 722
length of database: 12,070,560
effective HSP length: 80
effective length of database: 9,754,400
effective search space used: 1716774400
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)