BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00246 (484 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein ... 31 0.021 AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. 25 1.0 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 25 1.4 Z22930-5|CAA80517.1| 275|Anopheles gambiae trypsin protein. 24 3.1 AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. 23 4.2 AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-spe... 23 4.2 AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. 23 7.3 AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. 22 9.6 AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-... 22 9.6 AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transpo... 22 9.6 >AY957503-1|AAY41942.1| 596|Anopheles gambiae vasa-like protein protein. Length = 596 Score = 31.1 bits (67), Expect = 0.021 Identities = 14/41 (34%), Positives = 22/41 (53%) Frame = +1 Query: 352 EVTVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPTPIQ 474 +V VSG + ++ FE + + V V+ Y +PTPIQ Sbjct: 161 QVRVSGENPPDHVESFERSGLREEVMTNVRKSSYTKPTPIQ 201 >AY534996-1|AAT07394.1| 471|Anopheles gambiae XK-related b protein. Length = 471 Score = 25.4 bits (53), Expect = 1.0 Identities = 15/47 (31%), Positives = 22/47 (46%) Frame = -1 Query: 154 RRIIAEFVASSKFGTTVSTAIIPITRHDYFSDLVEDVYLNYGFFLTQ 14 RR+ A+ A ++F I+ YF D+V DV L Y + Q Sbjct: 59 RRVRAKSKAMTEFLPLCDVLFNVISLAGYFCDVVFDVVLGYALYERQ 105 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 25.0 bits (52), Expect = 1.4 Identities = 15/38 (39%), Positives = 21/38 (55%), Gaps = 6/38 (15%) Frame = -3 Query: 227 ALQRILFSHQSLQILQ------IYCHRCQTETNYRRIC 132 A +R+ SHQS IL+ I CHRC+ + +R C Sbjct: 180 AQKRMEKSHQSESILRVGPEKKITCHRCRKPGHMKRDC 217 >Z22930-5|CAA80517.1| 275|Anopheles gambiae trypsin protein. Length = 275 Score = 23.8 bits (49), Expect = 3.1 Identities = 10/30 (33%), Positives = 16/30 (53%) Frame = -3 Query: 230 CALQRILFSHQSLQILQIYCHRCQTETNYR 141 CA R+ H+S+Q L + R Q + +R Sbjct: 19 CAQARVALKHRSVQALPRFLPRPQYDVGHR 48 >AY578797-1|AAT07302.1| 304|Anopheles gambiae activin protein. Length = 304 Score = 23.4 bits (48), Expect = 4.2 Identities = 8/12 (66%), Positives = 9/12 (75%) Frame = -3 Query: 116 WNHRFHGYYSNY 81 W R HGYY+NY Sbjct: 197 WIIRPHGYYANY 208 >AF043440-1|AAC05665.1| 234|Anopheles gambiae putative pupal-specific cuticular proteinCP2d protein. Length = 234 Score = 23.4 bits (48), Expect = 4.2 Identities = 10/31 (32%), Positives = 17/31 (54%) Frame = +1 Query: 304 VLKRSPYEVEEYRNKHEVTVSGVEVHNPIQY 396 V++R P V+ + H+V V VH P+ + Sbjct: 139 VVRREPSAVKIAQPVHKVIAQPVHVHAPVAH 169 >AY135184-1|AAN17505.1| 1009|Anopheles gambiae laccase 1 protein. Length = 1009 Score = 22.6 bits (46), Expect = 7.3 Identities = 10/36 (27%), Positives = 19/36 (52%) Frame = +1 Query: 358 TVSGVEVHNPIQYFEEANFPDYVQQGVKTMGYKEPT 465 T S VE + ++EE ++ ++ + T+G K T Sbjct: 266 TASPVEPEEGVDFYEELSYDNHPCKRACTLGRKPET 301 >AY873992-1|AAW71999.1| 259|Anopheles gambiae nanos protein. Length = 259 Score = 22.2 bits (45), Expect = 9.6 Identities = 8/21 (38%), Positives = 15/21 (71%) Frame = +1 Query: 271 FNKNFYDPHPTVLKRSPYEVE 333 F KN+ D P ++ +SPY+++ Sbjct: 38 FLKNYPDFIPMLIGQSPYKID 58 >AY805323-1|AAV66543.1| 459|Anopheles gambiae beta subunit-GABA-A-gated chloride channelprotein. Length = 459 Score = 22.2 bits (45), Expect = 9.6 Identities = 18/58 (31%), Positives = 26/58 (44%), Gaps = 3/58 (5%) Frame = +1 Query: 295 HPTVLKRSPYEVEEYRNKHEVTVSGVEVH---NPIQYFEEANFPDYVQQGVKTMGYKE 459 +P + E+E Y TVS V ++ PI+ EEA P + G +T KE Sbjct: 149 YPLDSQNCTVEIESYG----YTVSDVVMYWRSTPIRGVEEAELPQFTIIGYETNDRKE 202 >AF543192-1|AAN40409.1| 636|Anopheles gambiae amino acid transporter Ag_AAT8 protein. Length = 636 Score = 22.2 bits (45), Expect = 9.6 Identities = 7/13 (53%), Positives = 11/13 (84%) Frame = -1 Query: 265 GVKQIPIWASHVV 227 G+ Q+PIWA++ V Sbjct: 584 GLLQLPIWAAYAV 596 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 469,356 Number of Sequences: 2352 Number of extensions: 8703 Number of successful extensions: 22 Number of sequences better than 10.0: 10 Number of HSP's better than 10.0 without gapping: 22 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 22 length of database: 563,979 effective HSP length: 60 effective length of database: 422,859 effective search space used: 42285900 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -