BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00245 (488 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cogna... 126 1e-31 AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock prote... 126 1e-31 AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock prote... 85 2e-19 AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 ... 30 0.013 AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 ... 29 0.023 DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc gr... 23 2.0 EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 p... 22 2.6 DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 22 3.4 AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 ... 22 3.4 AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 ... 22 3.4 AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxida... 21 7.9 AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. 21 7.9 AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger tran... 21 7.9 >AY769607-1|AAV40983.1| 196|Tribolium castaneum heat shock cognate 70 protein. Length = 196 Score = 126 bits (304), Expect = 1e-31 Identities = 58/77 (75%), Positives = 69/77 (89%) Frame = +1 Query: 256 DTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNKRALRRLRTACERAKRTLSSSTQASIEI 435 DTHLGGEDFDNR+V + Q+FK+K+K D++ N RALRRLRT CERAKRTLSS+TQASIEI Sbjct: 53 DTHLGGEDFDNRLVEYCTQDFKKKHKADISGNPRALRRLRTQCERAKRTLSSATQASIEI 112 Query: 436 DSLFEGIDFYTSITRAR 486 DSLF+GID+ T+ITRAR Sbjct: 113 DSLFDGIDYSTTITRAR 129 Score = 95.1 bits (226), Expect = 3e-22 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = +2 Query: 101 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTA 253 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TA Sbjct: 1 INEPTAAAIAYGLDKKAEKERNVLIFDLGGGTFDVSLLTIEEGIFEVKATA 51 >AY769606-1|AAV40982.1| 196|Tribolium castaneum heat shock protein 70 protein. Length = 196 Score = 126 bits (304), Expect = 1e-31 Identities = 58/77 (75%), Positives = 69/77 (89%) Frame = +1 Query: 256 DTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNKRALRRLRTACERAKRTLSSSTQASIEI 435 DTHLGGEDFDNR+V + Q+FK+K+K D++ N RALRRLRT CERAKRTLSS+TQASIEI Sbjct: 53 DTHLGGEDFDNRLVEYCTQDFKKKHKADISGNPRALRRLRTQCERAKRTLSSATQASIEI 112 Query: 436 DSLFEGIDFYTSITRAR 486 DSLF+GID+ T+ITRAR Sbjct: 113 DSLFDGIDYSTTITRAR 129 Score = 95.1 bits (226), Expect = 3e-22 Identities = 45/51 (88%), Positives = 48/51 (94%) Frame = +2 Query: 101 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTA 253 INEPTAAAIAYGLDKK ERNVLIFDLGGGTFDVS+LTIE+GIFEVK+TA Sbjct: 1 INEPTAAAIAYGLDKKAERERNVLIFDLGGGTFDVSLLTIEEGIFEVKATA 51 >AY769608-1|AAV40984.1| 195|Tribolium castaneum heat shock protein 70 protein. Length = 195 Score = 85.4 bits (202), Expect = 2e-19 Identities = 39/51 (76%), Positives = 48/51 (94%) Frame = +2 Query: 101 INEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDVSILTIEDGIFEVKSTA 253 INEPTAAAIAYGLDKKG E+N+L++DLGGGTFDVSILTI++G+FEV +T+ Sbjct: 1 INEPTAAAIAYGLDKKGA-EQNILVYDLGGGTFDVSILTIDNGVFEVVATS 50 Score = 82.2 bits (194), Expect = 2e-18 Identities = 35/77 (45%), Positives = 58/77 (75%) Frame = +1 Query: 256 DTHLGGEDFDNRMVNHFVQEFKRKYKKDLATNKRALRRLRTACERAKRTLSSSTQASIEI 435 DTHLGGEDFD +++++F++ K+K+KKD+ +K+AL++LR E+AKR LSS + ++ I Sbjct: 52 DTHLGGEDFDQKVMDYFIKMVKQKHKKDIRADKKALQKLRREVEKAKRDLSSVHKTTLTI 111 Query: 436 DSLFEGIDFYTSITRAR 486 ++L DF ++TRA+ Sbjct: 112 ENLLADYDFSETLTRAK 128 >AF251548-1|AAF70178.1| 491|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q4 protein. Length = 491 Score = 29.9 bits (64), Expect = 0.013 Identities = 16/38 (42%), Positives = 21/38 (55%) Frame = -1 Query: 338 SFLYFLLNSWTKWLTMRLSKSSPPKWVSRRWISPRRYH 225 SF+Y L+SW L L S+ PKW +RR I +H Sbjct: 101 SFIYHFLHSW---LGTGLLTSAGPKWQNRRKILTPAFH 135 >AY337337-2|AAP94193.1| 491|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 491 Score = 29.1 bits (62), Expect = 0.023 Identities = 16/38 (42%), Positives = 20/38 (52%) Frame = -1 Query: 338 SFLYFLLNSWTKWLTMRLSKSSPPKWVSRRWISPRRYH 225 SF+Y L+SW L L S PKW +RR I +H Sbjct: 101 SFIYHFLHSW---LGTGLLTSRGPKWQNRRKILTPAFH 135 >DQ659253-1|ABG47451.1| 439|Tribolium castaneum imaginal disc growth factor 2 protein. Length = 439 Score = 22.6 bits (46), Expect = 2.0 Identities = 9/22 (40%), Positives = 14/22 (63%) Frame = +2 Query: 56 TKDAGTISGLNVLRIINEPTAA 121 TKDAG +S + ++N+P A Sbjct: 330 TKDAGLLSYPEICTLLNDPQNA 351 >EF117815-1|ABO38438.1| 535|Tribolium castaneum cryptochrome 2 protein. Length = 535 Score = 22.2 bits (45), Expect = 2.6 Identities = 9/29 (31%), Positives = 14/29 (48%) Frame = +1 Query: 217 HRGWYLRGEIHRRDTHLGGEDFDNRMVNH 303 H W ++ R + G+D+ MVNH Sbjct: 458 HEPWTAPEQVQRAAKCIIGKDYSLPMVNH 486 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.8 bits (44), Expect = 3.4 Identities = 11/35 (31%), Positives = 14/35 (40%) Frame = +2 Query: 248 TAATPTWEVRTLTIAWSTTLSRSSRGNTKRTSLPT 352 T TW T T W TT + T+ T+ T Sbjct: 1036 TTKPSTWWSSTTTSPWWTTTTTRRTTTTRPTTTST 1070 >AY337337-1|AAP94192.1| 505|Tribolium castaneum cytochrome P450 monooxygenase protein. Length = 505 Score = 21.8 bits (44), Expect = 3.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 338 SFLYFLLNSWTKWLTMRLSKSSPPKWVSRRWISPRRYH 225 S +Y LL+ W L L S+ KW +RR I +H Sbjct: 108 SAIYNLLHDW---LGTGLLTSTGLKWQTRRKILTPAFH 142 >AF254755-1|AAF70496.1| 505|Tribolium castaneum cytochrome P450 monooxigenase CYP4Q7 protein. Length = 505 Score = 21.8 bits (44), Expect = 3.4 Identities = 14/38 (36%), Positives = 19/38 (50%) Frame = -1 Query: 338 SFLYFLLNSWTKWLTMRLSKSSPPKWVSRRWISPRRYH 225 S +Y LL+ W L L S+ KW +RR I +H Sbjct: 108 SAIYNLLHDW---LGTGLLTSTGLKWQTRRKILTPAFH 142 >AY884063-1|AAX84204.1| 682|Tribolium castaneum pro-phenol oxidase subunit 1 protein. Length = 682 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/16 (50%), Positives = 10/16 (62%) Frame = +1 Query: 235 RGEIHRRDTHLGGEDF 282 RG + R THL +DF Sbjct: 467 RGSVFVRFTHLQNQDF 482 >AY008296-1|AAG22858.1| 556|Tribolium castaneum Dorsal protein. Length = 556 Score = 20.6 bits (41), Expect = 7.9 Identities = 11/36 (30%), Positives = 18/36 (50%), Gaps = 1/36 (2%) Frame = -3 Query: 243 FTSKIPSSMVRIDT-SKVPPPRSKISTFRSPVPFLS 139 F IPS ++++ K P P F +P+P +S Sbjct: 380 FLLNIPSEGIKVEPRDKAPSPYGG-QMFEAPIPNVS 414 >AJ621748-1|CAF21851.1| 228|Tribolium castaneum zinc finger transcription factor protein. Length = 228 Score = 20.6 bits (41), Expect = 7.9 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +1 Query: 1 AECSYHGSRVLQ*LSKTSHKRCR 69 +EC +G V+ ++T+ K CR Sbjct: 40 SECKNNGECVINKKNRTACKACR 62 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 115,692 Number of Sequences: 336 Number of extensions: 2265 Number of successful extensions: 18 Number of sequences better than 10.0: 13 Number of HSP's better than 10.0 without gapping: 14 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 11420693 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 40 (21.2 bits)
- SilkBase 1999-2023 -