BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00245 (488 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 22 3.1 AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. 21 7.0 EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase p... 21 9.3 EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. 21 9.3 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 22.2 bits (45), Expect = 3.1 Identities = 12/31 (38%), Positives = 15/31 (48%) Frame = +2 Query: 44 QRQATKDAGTISGLNVLRIINEPTAAAIAYG 136 Q +A K A + N II+EPT YG Sbjct: 353 QAEAEKHAAMLYQYNFNIIISEPTERISPYG 383 >AB231585-1|BAE17127.1| 898|Apis mellifera Mahya protein. Length = 898 Score = 21.0 bits (42), Expect = 7.0 Identities = 10/41 (24%), Positives = 17/41 (41%) Frame = +2 Query: 83 LNVLRIINEPTAAAIAYGLDKKGTGERNVLIFDLGGGTFDV 205 LN+ I P+ Y + + N+L DL G ++ Sbjct: 787 LNISDIALYPSQTTHGYDIYASSIDKENILFLDLSTGKVEM 827 >EF540769-1|ABQ14707.1| 620|Apis mellifera adenosine deaminase protein. Length = 620 Score = 20.6 bits (41), Expect = 9.3 Identities = 12/40 (30%), Positives = 14/40 (35%) Frame = +2 Query: 296 STTLSRSSRGNTKRTSLPTRELLGVCVLHVRGQRGPCHRP 415 S+ R+ K EL V V Q GP H P Sbjct: 23 SSPKKRNKNPQPKNAVCALNELKSGAVYKVVDQTGPTHAP 62 >EF117814-1|ABO38437.1| 570|Apis mellifera cryptochrome 2 protein. Length = 570 Score = 20.6 bits (41), Expect = 9.3 Identities = 9/29 (31%), Positives = 13/29 (44%) Frame = +1 Query: 217 HRGWYLRGEIHRRDTHLGGEDFDNRMVNH 303 H W + R + G+D+ MVNH Sbjct: 462 HEPWNAPLNVQRAAKCIIGKDYSLPMVNH 490 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 138,695 Number of Sequences: 438 Number of extensions: 2915 Number of successful extensions: 4 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 4 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 4 length of database: 146,343 effective HSP length: 53 effective length of database: 123,129 effective search space used: 13421061 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -