BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00240 (838 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. 23 3.0 AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. 23 3.0 AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. 23 3.0 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 21 9.1 AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment h... 21 9.1 >DQ211693-1|ABB16909.1| 314|Tribolium castaneum dorsocross protein. Length = 314 Score = 23.0 bits (47), Expect = 3.0 Identities = 17/67 (25%), Positives = 26/67 (38%) Frame = -1 Query: 790 YNPKK*KILHEYKMNIERRNISWFHPDSPPNPYSPRFTVLPVFFTLLTKEPI*CLNGNRF 611 YNP K + +R+ + HPDSP + S + P KE + C + Sbjct: 193 YNPFAKGFRENGKSSAKRKQLVSEHPDSPNSKKSATPSPPPQLEVNERKENLTCQPAVPY 252 Query: 610 LKFCSRC 590 + F C Sbjct: 253 VPFYRYC 259 >AY584475-1|AAS93634.1| 209|Tribolium castaneum homothorax protein. Length = 209 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 174 SSTLRAPPSAGTSVASTGSPGPMTRRP 254 SS+L V S G+PGP+++ P Sbjct: 76 SSSLSYGGPVNDDVRSPGTPGPLSQAP 102 >AJ518941-1|CAD57735.1| 456|Tribolium castaneum homothorax protein. Length = 456 Score = 23.0 bits (47), Expect = 3.0 Identities = 10/27 (37%), Positives = 15/27 (55%) Frame = +3 Query: 174 SSTLRAPPSAGTSVASTGSPGPMTRRP 254 SS+L V S G+PGP+++ P Sbjct: 232 SSSLSYGGPVNDDVRSPGTPGPLSQAP 258 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 21.4 bits (43), Expect = 9.1 Identities = 7/10 (70%), Positives = 8/10 (80%) Frame = +3 Query: 426 YRAWQVDLGR 455 YR WQ+ LGR Sbjct: 344 YRHWQIPLGR 353 >AY695258-1|AAW21975.1| 232|Tribolium castaneum muscle segment homeodomain protein protein. Length = 232 Score = 21.4 bits (43), Expect = 9.1 Identities = 8/20 (40%), Positives = 12/20 (60%) Frame = +2 Query: 116 PEFKPKTPFGQMPVLEIDGK 175 P KP+TPF +L ++ K Sbjct: 114 PNRKPRTPFTTQQLLALEKK 133 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 167,199 Number of Sequences: 336 Number of extensions: 3337 Number of successful extensions: 8 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 8 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 122,585 effective HSP length: 56 effective length of database: 103,769 effective search space used: 23036718 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -