BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00239 (726 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. 25 0.73 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 23 2.9 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 23 2.9 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 23 3.9 DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. 22 5.1 AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor pr... 22 5.1 AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate r... 22 5.1 EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. 21 9.0 AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1al... 21 9.0 >DQ435331-1|ABD92646.1| 135|Apis mellifera OBP14 protein. Length = 135 Score = 25.0 bits (52), Expect = 0.73 Identities = 8/15 (53%), Positives = 12/15 (80%) Frame = -1 Query: 471 RLSCDCILREINVLD 427 +L C+CIL+ N+LD Sbjct: 60 QLYCECILKNFNILD 74 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 182 MPRGQRFSLDYFSLLR 135 +PRG+ FSL Y LLR Sbjct: 91 LPRGELFSLYYPQLLR 106 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.0 bits (47), Expect = 2.9 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 182 MPRGQRFSLDYFSLLR 135 +PRG+ FSL Y LLR Sbjct: 91 LPRGELFSLYYPQLLR 106 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 22.6 bits (46), Expect = 3.9 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 403 SRDVFNSDVQNIDFSKNTVAAKSIND 480 S ++ + QNID +KNT+ ND Sbjct: 410 SMEINQNIAQNIDHAKNTIIDYRNND 435 >DQ342041-1|ABC69933.1| 828|Apis mellifera STIP protein. Length = 828 Score = 22.2 bits (45), Expect = 5.1 Identities = 7/18 (38%), Positives = 12/18 (66%) Frame = -3 Query: 712 LSVRSLHIYNRRVYTSWV 659 L R++H Y+ V+ SW+ Sbjct: 460 LQTRTMHPYDHLVWNSWM 477 >AY937243-1|AAX33677.1| 1370|Apis mellifera Toll-like receptor protein. Length = 1370 Score = 22.2 bits (45), Expect = 5.1 Identities = 8/31 (25%), Positives = 21/31 (67%) Frame = +1 Query: 571 YFKGAWSSKFDERLTSDRDFYVSKDKTIKVP 663 +F+ +++++ +RLTS + +V K +++P Sbjct: 78 HFESSFNAQSWQRLTSLHELHVHGCKVLRIP 108 >AY331183-1|AAP94623.1| 953|Apis mellifera NMDA-type glutamate receptor 1 protein. Length = 953 Score = 22.2 bits (45), Expect = 5.1 Identities = 12/29 (41%), Positives = 16/29 (55%) Frame = -1 Query: 582 SLEIDGVTRTAAVAELSESGLTKSLCGYW 496 SL D VT A+ + ESG +SL +W Sbjct: 773 SLWADAVT--LAILDFHESGFMESLDNHW 799 >EF625898-1|ABR45905.1| 686|Apis mellifera hexamerin protein. Length = 686 Score = 21.4 bits (43), Expect = 9.0 Identities = 13/37 (35%), Positives = 19/37 (51%), Gaps = 2/37 (5%) Frame = +1 Query: 613 TSDRD--FYVSKDKTIKVPMMYKRGDYKYGESAHLMP 717 TS RD FY+ K + + YK+ +Y +S MP Sbjct: 413 TSMRDPAFYMLYQKILSYFLRYKKLQPQYSQSELQMP 449 >AF015267-1|AAC38959.1| 461|Apis mellifera elongation factor-1alpha F2 protein. Length = 461 Score = 21.4 bits (43), Expect = 9.0 Identities = 9/27 (33%), Positives = 13/27 (48%) Frame = +2 Query: 155 PGKSVVLSAFSVLPPLAQLALASDGET 235 P K + AF PPL + A+ +T Sbjct: 406 PSKPMCAEAFQEFPPLGRFAVRDMRQT 432 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 192,166 Number of Sequences: 438 Number of extensions: 3992 Number of successful extensions: 11 Number of sequences better than 10.0: 9 Number of HSP's better than 10.0 without gapping: 11 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 22535775 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -