SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00237
         (772 letters)

Database: mosquito 
           2352 sequences; 563,979 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

AF510719-1|AAP47148.1|  591|Anopheles gambiae ammonium transport...    25   3.4  
AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodi...    24   6.0  
AY705401-1|AAU12510.1|  490|Anopheles gambiae nicotinic acetylch...    23   7.9  
AY705400-1|AAU12509.1|  490|Anopheles gambiae nicotinic acetylch...    23   7.9  

>AF510719-1|AAP47148.1|  591|Anopheles gambiae ammonium
           transport-like protein protein.
          Length = 591

 Score = 24.6 bits (51), Expect = 3.4
 Identities = 7/17 (41%), Positives = 12/17 (70%)
 Frame = +3

Query: 567 QKCSFKLRCLIMFVNTV 617
           ++C+FK  C+  F NT+
Sbjct: 154 ERCNFKAYCIFSFFNTI 170


>AM422833-1|CAM12801.1| 2139|Anopheles gambiae voltage-gated sodium
            channel alpha subunitprotein.
          Length = 2139

 Score = 23.8 bits (49), Expect = 6.0
 Identities = 9/32 (28%), Positives = 16/32 (50%)
 Frame = +2

Query: 506  SNIYIYLLFNYFAVISDRLATKMLIQASLFNY 601
            +NIY+YL F +F +        + I   + N+
Sbjct: 1536 TNIYMYLYFVFFIIFGSFFTLNLFIGVIIDNF 1567


>AY705401-1|AAU12510.1|  490|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 6 protein.
          Length = 490

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = -3

Query: 377 PWKRHLYLSYLPW 339
           PW + ++L +LPW
Sbjct: 330 PWIKSVFLQWLPW 342


>AY705400-1|AAU12509.1|  490|Anopheles gambiae nicotinic
           acetylcholine receptor subunitalpha 6 protein.
          Length = 490

 Score = 23.4 bits (48), Expect = 7.9
 Identities = 6/13 (46%), Positives = 10/13 (76%)
 Frame = -3

Query: 377 PWKRHLYLSYLPW 339
           PW + ++L +LPW
Sbjct: 330 PWIKSVFLQWLPW 342


  Database: mosquito
    Posted date:  Oct 23, 2007  1:18 PM
  Number of letters in database: 563,979
  Number of sequences in database:  2352
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 706,564
Number of Sequences: 2352
Number of extensions: 12361
Number of successful extensions: 44
Number of sequences better than 10.0: 4
Number of HSP's better than 10.0 without gapping: 43
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 44
length of database: 563,979
effective HSP length: 63
effective length of database: 415,803
effective search space used: 80249979
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -