BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00236 (783 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. 25 2.6 AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein pr... 25 3.5 >EF519440-2|ABP73490.1| 165|Anopheles gambiae CTL4 protein. Length = 165 Score = 25.0 bits (52), Expect = 2.6 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +1 Query: 628 DVIVCLVIFVGGYRVHTA 681 D +VCL++ GYR TA Sbjct: 1 DTLVCLIVSTHGYRATTA 18 >AF387862-1|AAL56547.1| 476|Anopheles gambiae gag polyprotein protein. Length = 476 Score = 24.6 bits (51), Expect = 3.5 Identities = 13/35 (37%), Positives = 23/35 (65%), Gaps = 3/35 (8%) Frame = +1 Query: 430 IGKDTSF-RPSKWVKK--IPENPDKKLYNDEKQEY 525 + K+ +F RP V K + ENP ++L ND+++E+ Sbjct: 431 LSKNATFSRPVSVVLKGRLLENPSRRLRNDKQREF 465 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 735,396 Number of Sequences: 2352 Number of extensions: 14314 Number of successful extensions: 72 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 72 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 72 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 81913191 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -