BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00236 (783 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-act... 23 2.4 AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-act... 23 2.4 DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated... 23 3.2 AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cycl... 22 7.4 AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cycl... 22 7.4 DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride... 21 9.8 AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein ... 21 9.8 >AY739658-1|AAU85297.1| 664|Apis mellifera hyperpolarization-activated ion channelvariant L protein. Length = 664 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 328 SLFYYITLSTYYARLKLIKLNTFCNLYDQS 417 S F I L T R+ ++ T+CNL+ S Sbjct: 518 SYFGEICLLTNARRVASVRAETYCNLFSLS 547 >AY280848-1|AAQ16312.1| 632|Apis mellifera hyperpolarization-activated ion channel protein. Length = 632 Score = 23.4 bits (48), Expect = 2.4 Identities = 11/30 (36%), Positives = 16/30 (53%) Frame = +1 Query: 328 SLFYYITLSTYYARLKLIKLNTFCNLYDQS 417 S F I L T R+ ++ T+CNL+ S Sbjct: 486 SYFGEICLLTNARRVASVRAETYCNLFSLS 515 >DQ667195-1|ABG75747.1| 469|Apis mellifera cys-loop ligand-gated ion channel subunit protein. Length = 469 Score = 23.0 bits (47), Expect = 3.2 Identities = 11/36 (30%), Positives = 20/36 (55%) Frame = -1 Query: 216 TLNIYYYGSNAGN*RAYNMSFIVIKQLEIGNAVYYI 109 T + YYG AGN + +++F + +++ YYI Sbjct: 205 TTSQQYYGHFAGNFSSISITFKLAREMGFFMMDYYI 240 >AY769960-1|AAV34676.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -2 Query: 527 KYSCFSSLYNFLSGFSGIFLTHFD 456 KY C + L++ + GF H D Sbjct: 406 KYDCVTLLFSGIVGFGAYCAAHTD 429 >AB181489-1|BAD22772.1| 603|Apis mellifera soluble guanylyl cyclase beta 1 subunit protein. Length = 603 Score = 21.8 bits (44), Expect = 7.4 Identities = 8/24 (33%), Positives = 12/24 (50%) Frame = -2 Query: 527 KYSCFSSLYNFLSGFSGIFLTHFD 456 KY C + L++ + GF H D Sbjct: 406 KYDCVTLLFSGIVGFGAYCAAHTD 429 >DQ667192-1|ABG75744.1| 489|Apis mellifera pH-sensitive chloride channel variant 4 protein. Length = 489 Score = 21.4 bits (43), Expect = 9.8 Identities = 10/35 (28%), Positives = 14/35 (40%) Frame = +2 Query: 236 NSMAFVSKNRILNAGNYEASNKRRLSNRSRTLYFT 340 +S + + R GNY + R R YFT Sbjct: 271 DSKCSLCQRRFEEQGNYSCLKVDLIFTRDRAFYFT 305 >AY338499-1|AAR08420.1| 500|Apis mellifera Kruppel-like protein 1 protein. Length = 500 Score = 21.4 bits (43), Expect = 9.8 Identities = 12/35 (34%), Positives = 17/35 (48%) Frame = +1 Query: 259 KSHLERRKLRGKQQAPTIEPF*DSLFYYITLSTYY 363 +SHL + R Q PT+ LF Y +S+ Y Sbjct: 347 QSHLISNENRDFQTTPTVSVEQPHLFLYPEVSSTY 381 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 199,728 Number of Sequences: 438 Number of extensions: 4218 Number of successful extensions: 11 Number of sequences better than 10.0: 7 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 11 length of database: 146,343 effective HSP length: 57 effective length of database: 121,377 effective search space used: 24639531 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -