BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00234 (676 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPBC543.05c |||inorganic anion exchanger |Schizosaccharomyces po... 27 1.9 SPAC144.16 |||DUF59 family protein|Schizosaccharomyces pombe|chr... 27 3.3 SPBC29A3.14c |trt1||telomerase reverse transcriptase 1 protein T... 26 4.3 SPAC17C9.01c |nuc2|apc3, SPAC1851.01|anaphase-promoting complex ... 26 4.3 SPAC25H1.07 |||DUF1620 family protein|Schizosaccharomyces pombe|... 25 10.0 SPAC1296.01c ||SPAC22F3.01|phosphoacetylglucosamine mutase |Schi... 25 10.0 >SPBC543.05c |||inorganic anion exchanger |Schizosaccharomyces pombe|chr 2|||Manual Length = 517 Score = 27.5 bits (58), Expect = 1.9 Identities = 14/42 (33%), Positives = 22/42 (52%), Gaps = 4/42 (9%) Frame = +1 Query: 418 TVVFYYNRNVSRQMALDP----YNSVAYHPSTFVASVQT*IS 531 T++FY++ NVS MA DP +H F+ + T +S Sbjct: 285 TILFYFDHNVSSVMAQDPSFPLTKPAGFHWDFFLLGITTGVS 326 >SPAC144.16 |||DUF59 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 179 Score = 26.6 bits (56), Expect = 3.3 Identities = 12/39 (30%), Positives = 21/39 (53%) Frame = +2 Query: 242 VCIRLRTRKCLAAKLGIEAHFFKSAYTEKANEGSANKEL 358 +CIR+R +CL + ++ K + A+E NK+L Sbjct: 117 LCIRVRLERCLPPRFHVDVKVKKGTH---ASESQVNKQL 152 >SPBC29A3.14c |trt1||telomerase reverse transcriptase 1 protein Trt1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 988 Score = 26.2 bits (55), Expect = 4.3 Identities = 14/31 (45%), Positives = 21/31 (67%), Gaps = 1/31 (3%) Frame = +3 Query: 294 RRIF-LNLRILKKLMKEARIRSFSLKYCLSN 383 +RIF + L+ L+ +K +R SFSL Y +SN Sbjct: 363 QRIFEIILKDLETFLKLSRYESFSLHYLMSN 393 >SPAC17C9.01c |nuc2|apc3, SPAC1851.01|anaphase-promoting complex subunit Apc3|Schizosaccharomyces pombe|chr 1|||Manual Length = 665 Score = 26.2 bits (55), Expect = 4.3 Identities = 23/81 (28%), Positives = 41/81 (50%), Gaps = 7/81 (8%) Frame = +2 Query: 221 WNIFYQCVCIRL---RTRKCLAAKLGIEAHFFKSAYTEKANEGSANKELLLKILSFK--- 382 W I C ++ + KC+ + ++ F + AYT + +E SAN+E SF+ Sbjct: 434 WCILANCFSLQREHSQALKCINRAIQLDPTF-EYAYTLQGHEHSANEEYEKSKTSFRKAI 492 Query: 383 *VNM-YINYHHGLLLFFIITG 442 VN+ + N +GL + ++ TG Sbjct: 493 RVNVRHYNAWYGLGMVYLKTG 513 >SPAC25H1.07 |||DUF1620 family protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 885 Score = 25.0 bits (52), Expect = 10.0 Identities = 8/23 (34%), Positives = 14/23 (60%) Frame = +2 Query: 392 MYINYHHGLLLFFIITGTLADRW 460 +Y N H G++LF + G ++ W Sbjct: 654 VYQNKHQGIILFDKVYGVFSENW 676 >SPAC1296.01c ||SPAC22F3.01|phosphoacetylglucosamine mutase |Schizosaccharomyces pombe|chr 1|||Manual Length = 542 Score = 25.0 bits (52), Expect = 10.0 Identities = 14/33 (42%), Positives = 18/33 (54%) Frame = -3 Query: 623 CLLLVSKIAILFPCSEKSIIVGHGYSKRFTNEI 525 CL + K A + P SE + V GY R T+EI Sbjct: 119 CLTSILKKAKIIPGSEARVFV--GYDSRSTSEI 149 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,692,139 Number of Sequences: 5004 Number of extensions: 53377 Number of successful extensions: 126 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 123 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 126 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 309878492 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -