BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00234 (676 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase pr... 23 6.7 AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylch... 23 8.8 >AY056833-1|AAL23627.1| 1253|Anopheles gambiae chitin synthase protein. Length = 1253 Score = 23.4 bits (48), Expect = 6.7 Identities = 9/35 (25%), Positives = 21/35 (60%) Frame = +3 Query: 318 ILKKLMKEARIRSFSLKYCLSNKLTCTLIIITVYC 422 I K + +I+SFS+ + ++ + T+ ++ V+C Sbjct: 47 IFSKFACKIQIQSFSMAFPINLAVPVTVTLLLVFC 81 >AY705399-1|AAU12508.1| 533|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 5 protein. Length = 533 Score = 23.0 bits (47), Expect = 8.8 Identities = 8/19 (42%), Positives = 10/19 (52%) Frame = -1 Query: 661 NVYHKIQIIKQKTVYCWSV 605 N YH Q KQ +Y W + Sbjct: 3 NRYHNFQCYKQLRIYKWII 21 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 671,136 Number of Sequences: 2352 Number of extensions: 13022 Number of successful extensions: 16 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 563,979 effective HSP length: 62 effective length of database: 418,155 effective search space used: 67741110 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -