BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00234 (676 letters) Database: celegans 27,780 sequences; 12,740,198 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value U41748-5|AAA83338.1| 364|Caenorhabditis elegans Hypothetical pr... 28 5.3 Z79604-4|CAB60456.1| 598|Caenorhabditis elegans Hypothetical pr... 27 9.2 >U41748-5|AAA83338.1| 364|Caenorhabditis elegans Hypothetical protein C31H2.4 protein. Length = 364 Score = 28.3 bits (60), Expect = 5.3 Identities = 11/44 (25%), Positives = 27/44 (61%) Frame = -1 Query: 661 NVYHKIQIIKQKTVYCWSVRSQFYSRVQRSLL*SVMAIQNDLQM 530 ++ +QI+K ++V ++ SQ+Y ++ L + + ++ DL+M Sbjct: 255 DIISAVQIMKSRSVEFLTIPSQYYDNLEERLSKTNLIVKEDLKM 298 >Z79604-4|CAB60456.1| 598|Caenorhabditis elegans Hypothetical protein ZK662.5 protein. Length = 598 Score = 27.5 bits (58), Expect = 9.2 Identities = 11/38 (28%), Positives = 24/38 (63%) Frame = -3 Query: 248 YIHIDKKYSIM*ITNRMSFVNASSNGLIKKYNRTYYNY 135 Y + ++S + +N+ + ++NGL+K+YN +Y+Y Sbjct: 192 YSFSNVRFSNLVCSNQNVYNVFATNGLVKRYNICFYSY 229 Database: celegans Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 12,740,198 Number of sequences in database: 27,780 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,629,659 Number of Sequences: 27780 Number of extensions: 293609 Number of successful extensions: 655 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 631 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 655 length of database: 12,740,198 effective HSP length: 79 effective length of database: 10,545,578 effective search space used: 1529108810 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -