BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00229 (755 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPCC757.07c |ctt1|cta1|catalase|Schizosaccharomyces pombe|chr 3|... 27 3.8 SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|c... 26 6.7 SPBP8B7.19 |spt16||FACT complex component Spt16|Schizosaccharomy... 25 8.8 SPBC4F6.09 |str1||siderophore-iron transporter Str1 |Schizosacch... 25 8.8 >SPCC757.07c |ctt1|cta1|catalase|Schizosaccharomyces pombe|chr 3|||Manual Length = 512 Score = 26.6 bits (56), Expect = 3.8 Identities = 9/23 (39%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -1 Query: 80 GSTAHNH-YANDGDKYYFCKIHF 15 G ++H + + ND ++Y+CK HF Sbjct: 200 GFSSHTYKFVNDKGEFYYCKWHF 222 >SPAP8A3.12c |||tripeptidylpeptidase |Schizosaccharomyces pombe|chr 1|||Manual Length = 1274 Score = 25.8 bits (54), Expect = 6.7 Identities = 12/34 (35%), Positives = 18/34 (52%) Frame = +3 Query: 645 KLIEQWKNSLEF*RSRAGVGYTMTPSDLRKCYEK 746 KL ++WKN + + + Y P DLRK +K Sbjct: 159 KLSKEWKNPSKKWKVGCKLAYEFFPKDLRKRLQK 192 >SPBP8B7.19 |spt16||FACT complex component Spt16|Schizosaccharomyces pombe|chr 2|||Manual Length = 1019 Score = 25.4 bits (53), Expect = 8.8 Identities = 13/48 (27%), Positives = 25/48 (52%) Frame = +1 Query: 112 WVREFAIRSSALVQQSTYSKRLKD*STVLNQRKTNKIR*SVVVEQSEM 255 ++R F RSS + S K ++D +R+T + + V+EQ ++ Sbjct: 605 FIRSFTFRSSNNSRMSQVFKDIQDMKKAATKRETERKEFADVIEQDKL 652 >SPBC4F6.09 |str1||siderophore-iron transporter Str1 |Schizosaccharomyces pombe|chr 2|||Manual Length = 612 Score = 25.4 bits (53), Expect = 8.8 Identities = 8/16 (50%), Positives = 13/16 (81%) Frame = -1 Query: 635 FMFIFLRYYCCDNYFY 588 F+F ++ +YC DNY+Y Sbjct: 376 FLF-YITFYCWDNYYY 390 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,872,793 Number of Sequences: 5004 Number of extensions: 54297 Number of successful extensions: 147 Number of sequences better than 10.0: 4 Number of HSP's better than 10.0 without gapping: 143 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 147 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 361294920 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -