BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00229 (755 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 12_01_0913 + 8882193-8883510,8887633-8887865,8889619-8889871,889... 29 3.0 05_05_0387 + 24577448-24577638,24580375-24580767,24581078-245812... 28 9.2 >12_01_0913 + 8882193-8883510,8887633-8887865,8889619-8889871, 8891281-8891470,8891641-8891773,8891797-8891886 Length = 738 Score = 29.5 bits (63), Expect = 3.0 Identities = 11/28 (39%), Positives = 18/28 (64%) Frame = -1 Query: 530 HNHILCMNVFLTLTYQHLVIPISTIAVR 447 H+H+L + + L L + HLV+P + A R Sbjct: 8 HHHVLVLQLILLLPFLHLVVPGTPAAAR 35 >05_05_0387 + 24577448-24577638,24580375-24580767,24581078-24581208, 24581460-24581899 Length = 384 Score = 27.9 bits (59), Expect = 9.2 Identities = 12/34 (35%), Positives = 21/34 (61%) Frame = -1 Query: 146 SADDRIANSLTHTFKLFKKVPSGSTAHNHYANDG 45 +++D +A+ L FKL K+ S +A H+ N+G Sbjct: 279 TSEDEVADWLIERFKLKNKLLSDFSALGHFPNEG 312 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 16,899,186 Number of Sequences: 37544 Number of extensions: 296575 Number of successful extensions: 646 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 632 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 646 length of database: 14,793,348 effective HSP length: 80 effective length of database: 11,789,828 effective search space used: 2016060588 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -