BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00228 (622 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr... 45 1e-05 SPMIT.06 |||mitochondrial DNA binding endonuclease|Schizosacchar... 29 0.54 >SPAC23A1.09 |||RNA-binding protein|Schizosaccharomyces pombe|chr 1|||Manual Length = 121 Score = 44.8 bits (101), Expect = 1e-05 Identities = 23/55 (41%), Positives = 33/55 (60%), Gaps = 1/55 (1%) Frame = +1 Query: 460 PQRSVEGWILLSVXXXXXXXXXXXXXIFRVW*D-KNIPLNLDRRTGFLKGYALVE 621 P +SVEG+I++ +F + KN+ LNLDRRTG++KGYAL+E Sbjct: 3 PAKSVEGYIIIVTGVHPEATEEQVEDLFADFGPVKNLHLNLDRRTGYVKGYALIE 57 >SPMIT.06 |||mitochondrial DNA binding endonuclease|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 807 Score = 29.1 bits (62), Expect = 0.54 Identities = 13/47 (27%), Positives = 24/47 (51%) Frame = -1 Query: 565 YSYLTKLGKLXLYIFFLCFSCTLLTTGSSLQLISEVLVYRYRLPELN 425 YS++ G+ Y++F+ C L T L L + + V + P+L+ Sbjct: 641 YSFVHNRGRFATYVYFIIKDCVLRTLAHKLSLGTRMKVIKKFGPDLS 687 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 1,446,634 Number of Sequences: 5004 Number of extensions: 23187 Number of successful extensions: 75 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 74 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 75 length of database: 2,362,478 effective HSP length: 70 effective length of database: 2,012,198 effective search space used: 273658928 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -