SilkBase IMG001 IMG002 IMG003 IMG005 IMG006 IMG007 IMG008 IMG009 kuwako IMG010 IMG011 IMG012

Last updated: 2022/11/18
BLASTX 2.2.12 [Aug-07-2005]


Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Query= wdS00228
         (622 letters)

Database: arabidopsis 
           28,952 sequences; 12,070,560 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

At1g51510.1 68414.m05797 RNA-binding protein, putative similar t...    60   2e-09

>At1g51510.1 68414.m05797 RNA-binding protein, putative similar to
           RNA-binding protein 8 (Ribonucleoprotein RBM8) SP:Q9Y5S9
           from [Homo sapiens], RNA-binding protein Y14 [Xenopus
           laevis] GI:11034807; contains InterPro entry IPR000504:
           RNA-binding region RNP-1 (RNA recognition motif) (RRM)
          Length = 202

 Score = 59.7 bits (138), Expect = 2e-09
 Identities = 30/62 (48%), Positives = 38/62 (61%), Gaps = 1/62 (1%)
 Frame = +1

Query: 439 GDSGTPGPQRSVEGWILLSVXXXXXXXXXXXXXIFRVW*D-KNIPLNLDRRTGFLKGYAL 615
           G  G PGPQRSVEGWI+L                F  + + KN+ LNLDRR+G++KGYAL
Sbjct: 81  GSDGRPGPQRSVEGWIILVSGVHEETQEEDITNAFGDFGEIKNLNLNLDRRSGYVKGYAL 140

Query: 616 VE 621
           +E
Sbjct: 141 IE 142


  Database: arabidopsis
    Posted date:  Oct 4, 2007 10:56 AM
  Number of letters in database: 12,070,560
  Number of sequences in database:  28,952
  
Lambda     K      H
   0.318    0.134    0.401 

Gapped
Lambda     K      H
   0.279   0.0580    0.190 


Matrix: BLOSUM62
Gap Penalties: Existence: 9, Extension: 2
Number of Hits to DB: 7,428,258
Number of Sequences: 28952
Number of extensions: 119777
Number of successful extensions: 326
Number of sequences better than 10.0: 1
Number of HSP's better than 10.0 without gapping: 321
Number of HSP's successfully gapped in prelim test: 0
Number of HSP's that attempted gapping in prelim test: 0
Number of HSP's gapped (non-prelim): 325
length of database: 12,070,560
effective HSP length: 78
effective length of database: 9,812,304
effective search space used: 1255974912
frameshift window, decay const: 40,  0.1
T: 12
A: 40
X1: 16 ( 7.3 bits)
X2: 37 (14.9 bits)
X3: 62 (25.0 bits)
S1: 41 (21.7 bits)

- SilkBase 1999-2023 -