BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00226 (658 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecul... 27 0.21 AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member A... 27 0.21 AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. 25 0.84 EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. 24 1.5 EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. 24 1.5 AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisp... 22 4.5 AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisp... 22 4.5 AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisp... 22 4.5 DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. 22 5.9 AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. 22 5.9 AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. 22 5.9 AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. 22 5.9 AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice... 21 7.8 AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. 21 7.8 >AB269871-1|BAF03050.1| 1923|Apis mellifera cell adhesion molecule AbsCAM-Ig7B protein. Length = 1923 Score = 26.6 bits (56), Expect = 0.21 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = +1 Query: 265 IRRNEKIAVHCTVRGAKAEEILER---GLKVREY-ELRRDNFSATGNFGFGIQEHI 420 + RN+ +A+HC +G I+ + G K EY ELR ++ + G + +H+ Sbjct: 721 VERNKHVALHCQAQGVPTPTIVWKKATGSKSGEYEELRERAYTKILSNGTLLLQHV 776 >AB257298-1|BAE93381.1| 1919|Apis mellifera Dscam family member AbsCAM-Ig7A protein. Length = 1919 Score = 26.6 bits (56), Expect = 0.21 Identities = 16/56 (28%), Positives = 29/56 (51%), Gaps = 4/56 (7%) Frame = +1 Query: 265 IRRNEKIAVHCTVRGAKAEEILER---GLKVREY-ELRRDNFSATGNFGFGIQEHI 420 + RN+ +A+HC +G I+ + G K EY ELR ++ + G + +H+ Sbjct: 717 VERNKHVALHCQAQGVPTPTIVWKKATGSKSGEYEELRERAYTKILSNGTLLLQHV 772 >AY588474-1|AAT94401.1| 104|Apis mellifera defensin 2 protein. Length = 104 Score = 24.6 bits (51), Expect = 0.84 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = +2 Query: 29 SCNHGACTTACVEER*KG 82 S NH AC C+ +R KG Sbjct: 75 SINHSACAIRCLAQRRKG 92 >EF625897-1|ABR45904.1| 684|Apis mellifera hexamerin protein. Length = 684 Score = 23.8 bits (49), Expect = 1.5 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -3 Query: 53 WYTRHDYNFSKK 18 WY HDYN K Sbjct: 208 WYLNHDYNLENK 219 >EF591128-1|ABQ59246.1| 684|Apis mellifera hexamerin 70a protein. Length = 684 Score = 23.8 bits (49), Expect = 1.5 Identities = 7/12 (58%), Positives = 7/12 (58%) Frame = -3 Query: 53 WYTRHDYNFSKK 18 WY HDYN K Sbjct: 208 WYLNHDYNLENK 219 >AF388659-3|AAK71993.1| 548|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform C protein. Length = 548 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 316 AEEILERGLKVREYELRRDNFSATGNFGFGIQ 411 AEE +G+ Y + R+ S+T GF ++ Sbjct: 386 AEERRVQGVTKPRYMVWRETISSTATLGFRVE 417 >AF388659-2|AAK71994.1| 463|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform B protein. Length = 463 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 316 AEEILERGLKVREYELRRDNFSATGNFGFGIQ 411 AEE +G+ Y + R+ S+T GF ++ Sbjct: 301 AEERRVQGVTKPRYMVWRETISSTATLGFRVE 332 >AF388659-1|AAK71995.1| 782|Apis mellifera 1D-myo-inositol-trisphosphate 3-kinaseisoform A protein. Length = 782 Score = 22.2 bits (45), Expect = 4.5 Identities = 10/32 (31%), Positives = 17/32 (53%) Frame = +1 Query: 316 AEEILERGLKVREYELRRDNFSATGNFGFGIQ 411 AEE +G+ Y + R+ S+T GF ++ Sbjct: 620 AEERRVQGVTKPRYMVWRETISSTATLGFRVE 651 >DQ435326-1|ABD92641.1| 132|Apis mellifera OBP9 protein. Length = 132 Score = 21.8 bits (44), Expect = 5.9 Identities = 8/13 (61%), Positives = 10/13 (76%) Frame = -1 Query: 658 FFLSFITFIYLYF 620 FF+ IT I+LYF Sbjct: 8 FFILVITLIFLYF 20 >AY336529-1|AAQ02340.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 362 CGVTTSPPRVILASVFKN 415 C + PPRVIL+S K+ Sbjct: 626 CNLGLEPPRVILSSGAKS 643 >AY336528-1|AAQ02339.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 362 CGVTTSPPRVILASVFKN 415 C + PPRVIL+S K+ Sbjct: 626 CNLGLEPPRVILSSGAKS 643 >AY217097-1|AAO39761.1| 712|Apis mellifera transferrin protein. Length = 712 Score = 21.8 bits (44), Expect = 5.9 Identities = 9/18 (50%), Positives = 12/18 (66%) Frame = +2 Query: 362 CGVTTSPPRVILASVFKN 415 C + PPRVIL+S K+ Sbjct: 626 CNLGLEPPRVILSSGAKS 643 >AY268031-1|AAP23056.1| 810|Apis mellifera dorsal protein splice variant B protein. Length = 810 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 207 NSQDNSLYFPRLGIQCV 257 +S++ ++ F LGIQCV Sbjct: 132 SSENMTVTFANLGIQCV 148 >AY268030-1|AAP23055.1| 602|Apis mellifera dorsal protein protein. Length = 602 Score = 21.4 bits (43), Expect = 7.8 Identities = 8/17 (47%), Positives = 13/17 (76%) Frame = +3 Query: 207 NSQDNSLYFPRLGIQCV 257 +S++ ++ F LGIQCV Sbjct: 132 SSENMTVTFANLGIQCV 148 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 174,424 Number of Sequences: 438 Number of extensions: 3939 Number of successful extensions: 16 Number of sequences better than 10.0: 14 Number of HSP's better than 10.0 without gapping: 16 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 16 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 19734030 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -