BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00217 (531 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 pro... 21 5.1 AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like prote... 21 5.1 EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxyla... 21 6.8 AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less prot... 21 6.8 DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired pr... 21 8.9 >DQ659250-1|ABG47448.1| 2700|Tribolium castaneum chitinase 10 protein. Length = 2700 Score = 21.4 bits (43), Expect = 5.1 Identities = 8/14 (57%), Positives = 10/14 (71%) Frame = -3 Query: 46 SHWETQGDTEFPPA 5 ++W TQG T PPA Sbjct: 1077 TNWPTQGTTIPPPA 1090 >AY600513-1|AAT11861.1| 314|Tribolium castaneum spalt-like protein protein. Length = 314 Score = 21.4 bits (43), Expect = 5.1 Identities = 14/48 (29%), Positives = 19/48 (39%), Gaps = 4/48 (8%) Frame = +2 Query: 341 PKNVLICGRVLPQTRALSLEYTFKIS----SCVLLSFPSTSKSNPKNY 472 P +IC RVL AL + Y C + T+K N K + Sbjct: 134 PNQCVICHRVLSCKSALQMHYRTHTGERPFKCKICGRAFTTKGNLKTH 181 >EU019710-1|ABU25222.1| 475|Tribolium castaneum dopa decarboxylase protein. Length = 475 Score = 21.0 bits (42), Expect = 6.8 Identities = 10/41 (24%), Positives = 19/41 (46%) Frame = +2 Query: 101 VQGIKGRLNRLPAAGSGDMIVATVKKGKPELRKKVMPAVVI 223 +QG + G+ ++ VKK KPE+ + A ++ Sbjct: 144 IQGTASEATLVALLGAKARMIDRVKKEKPEMSDSEIVAKLV 184 >AF317551-1|AAG39634.1| 312|Tribolium castaneum distal-less protein. Length = 312 Score = 21.0 bits (42), Expect = 6.8 Identities = 9/22 (40%), Positives = 13/22 (59%) Frame = -1 Query: 96 ITYRFFAPVLSAQLITAPTGRP 31 I RF + + A L+T+P RP Sbjct: 225 IVERFTSDRVHAALVTSPRARP 246 >DQ414248-1|ABD63010.2| 311|Tribolium castaneum sloppy-paired protein. Length = 311 Score = 20.6 bits (41), Expect = 8.9 Identities = 7/22 (31%), Positives = 14/22 (63%) Frame = +2 Query: 401 YTFKISSCVLLSFPSTSKSNPK 466 Y F++ +L PS++ S+P+ Sbjct: 272 YNFRVPQHQVLQSPSSTSSSPE 293 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 122,360 Number of Sequences: 336 Number of extensions: 2781 Number of successful extensions: 5 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 5 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5 length of database: 122,585 effective HSP length: 53 effective length of database: 104,777 effective search space used: 12887571 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -