BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00214 (734 letters) Database: tribolium 336 sequences; 122,585 total letters Searching.......................................................done Score E Sequences producing significant alignments: (bits) Value AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory recept... 23 2.6 AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory recept... 23 3.4 AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory recept... 22 5.9 >AM292340-1|CAL23152.1| 355|Tribolium castaneum gustatory receptor candidate 19 protein. Length = 355 Score = 23.0 bits (47), Expect = 2.6 Identities = 9/23 (39%), Positives = 13/23 (56%) Frame = -3 Query: 213 FFFLCILFGCMGYFRFSRHIRFL 145 FF LCI + + F+ H+ FL Sbjct: 141 FFLLCIYYFYCAFIIFTVHLLFL 163 Score = 22.6 bits (46), Expect = 3.4 Identities = 11/35 (31%), Positives = 16/35 (45%) Frame = +2 Query: 59 CKFYNYLVFKCFFLFRLLVLCKKSFVTCYKKRICL 163 C +Y Y F F + L +LC FV +C+ Sbjct: 112 CVYYFYYAFIIFTVHLLFLLCIYYFVVPLFFLLCI 146 >AM292323-1|CAL23135.2| 587|Tribolium castaneum gustatory receptor candidate 2 protein. Length = 587 Score = 22.6 bits (46), Expect = 3.4 Identities = 8/17 (47%), Positives = 11/17 (64%) Frame = +3 Query: 144 IKNEYVWRT*SSPYTRR 194 IKNE +W+ YTR+ Sbjct: 258 IKNEIIWKKLREDYTRQ 274 >AM292367-1|CAL23179.2| 1451|Tribolium castaneum gustatory receptor candidate 46 protein. Length = 1451 Score = 21.8 bits (44), Expect = 5.9 Identities = 12/42 (28%), Positives = 20/42 (47%) Frame = +2 Query: 14 VRHFFGLKNLETANRCKFYNYLVFKCFFLFRLLVLCKKSFVT 139 V+ F ++L R F + V C+ L+++ K FVT Sbjct: 513 VQRFNNYQSLAHYLRVFFTVFNVVHCYLASELVLMLKNRFVT 554 Database: tribolium Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 122,585 Number of sequences in database: 336 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 165,327 Number of Sequences: 336 Number of extensions: 3434 Number of successful extensions: 10 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 9 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 10 length of database: 122,585 effective HSP length: 55 effective length of database: 104,105 effective search space used: 19675845 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -