BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00210 (504 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) 53 1e-07 SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) 52 2e-07 SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) 52 3e-07 SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) 49 3e-06 SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) 49 3e-06 SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) 46 1e-05 SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) 46 1e-05 SB_26666| Best HMM Match : Pkinase (HMM E-Value=3.7e-38) 46 1e-05 SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) 46 2e-05 SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) 45 3e-05 SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) 45 3e-05 SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) 44 5e-05 SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) 44 9e-05 SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) 43 1e-04 SB_8000| Best HMM Match : No HMM Matches (HMM E-Value=.) 43 1e-04 SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) 43 2e-04 SB_23777| Best HMM Match : Pkinase (HMM E-Value=0.065) 43 2e-04 SB_17071| Best HMM Match : Pkinase (HMM E-Value=0.065) 43 2e-04 SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) 42 4e-04 SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) 41 5e-04 SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_24054| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 9e-04 SB_20101| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.001 SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) 40 0.001 SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) 40 0.002 SB_22883| Best HMM Match : Pkinase (HMM E-Value=6.4e-12) 39 0.002 SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) 39 0.002 SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.004 SB_38533| Best HMM Match : Pkinase (HMM E-Value=0.15) 38 0.004 SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) 38 0.005 SB_4962| Best HMM Match : FAD_binding_4 (HMM E-Value=5.7e-31) 38 0.005 SB_42409| Best HMM Match : Pkinase (HMM E-Value=6.7e-24) 38 0.006 SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_6976| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) 38 0.006 SB_30262| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.008 SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.008 SB_57764| Best HMM Match : No HMM Matches (HMM E-Value=.) 37 0.011 SB_21476| Best HMM Match : Pkinase_C (HMM E-Value=0.001) 37 0.011 SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.014 SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.014 SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) 36 0.019 SB_40213| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.1e-07) 36 0.019 SB_36849| Best HMM Match : No HMM Matches (HMM E-Value=.) 36 0.025 SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) 36 0.025 SB_55249| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.033 SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.044 SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.044 SB_9807| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.00031) 35 0.044 SB_8812| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.044 SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) 35 0.044 SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.058 SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) 34 0.058 SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) 34 0.077 SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) 34 0.077 SB_47182| Best HMM Match : Pkinase (HMM E-Value=1e-09) 33 0.10 SB_48846| Best HMM Match : Pkinase_Tyr (HMM E-Value=8.1e-16) 33 0.13 SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) 33 0.13 SB_31697| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.13 SB_31555| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 33 0.13 SB_47579| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.18 SB_27678| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.18 SB_29237| Best HMM Match : I-set (HMM E-Value=0) 33 0.18 SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) 33 0.18 SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) 32 0.23 SB_18517| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.23 SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_30712| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.31 SB_28695| Best HMM Match : Ras (HMM E-Value=0) 32 0.31 SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) 32 0.31 SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.41 SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) 31 0.71 SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.71 SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) 31 0.71 SB_6393| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-28) 31 0.71 SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 31 0.71 SB_42225| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 30 0.94 SB_36282| Best HMM Match : HHH (HMM E-Value=7.4) 30 0.94 SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) 30 1.2 SB_4877| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.2 SB_20885| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 1.6 SB_19785| Best HMM Match : SRR1 (HMM E-Value=8.8e-19) 29 1.6 SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) 29 2.2 SB_18127| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_3163| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.2 SB_39250| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) 29 2.2 SB_11865| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.7e-07) 29 2.2 SB_53713| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.9 SB_35913| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 29 2.9 SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) 28 5.0 SB_44172| Best HMM Match : Pkinase_Tyr (HMM E-Value=6.3e-20) 27 6.6 SB_27024| Best HMM Match : Pkinase (HMM E-Value=4.7e-25) 27 6.6 SB_57199| Best HMM Match : 7tm_1 (HMM E-Value=0) 27 6.6 SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) 27 6.6 SB_8610| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_2736| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 6.6 SB_55640| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 8.8 SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) 27 8.8 SB_40820| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) 27 8.8 SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) 27 8.8 SB_45| Best HMM Match : Pkinase (HMM E-Value=0) 27 8.8 >SB_26967| Best HMM Match : Pkinase (HMM E-Value=0) Length = 428 Score = 53.2 bits (122), Expect = 1e-07 Identities = 23/69 (33%), Positives = 46/69 (66%) Frame = +2 Query: 281 SLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRL 460 ++ +++LG LG G FG V LA + + + VA+K+L +++I ++ ++RRE++ Sbjct: 16 AIGNYNLGETLGVGTFGKVKLAVHQLTGHKVAIKILNRNKIKSLDVVGKIRREIQNLKLF 75 Query: 461 RHPNILRMY 487 RHP+I+++Y Sbjct: 76 RHPHIIKLY 84 >SB_42711| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 920 Score = 52.4 bits (120), Expect = 2e-07 Identities = 24/75 (32%), Positives = 49/75 (65%) Frame = +2 Query: 263 DKKKTWSLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREV 442 D+ K + +++ + +GKG F V LAR + + VA+K++ K+Q+ + ++ ++ REV Sbjct: 147 DRSKAIRVGFYEIDKTIGKGNFSVVKLARHRITKSQVAIKIIDKTQLNEMNLK-KIYREV 205 Query: 443 EIQCRLRHPNILRMY 487 +I L+HP+I+++Y Sbjct: 206 QIMKLLQHPHIVKLY 220 >SB_2079| Best HMM Match : Pkinase (HMM E-Value=4.2e-10) Length = 210 Score = 52.0 bits (119), Expect = 3e-07 Identities = 23/80 (28%), Positives = 49/80 (61%), Gaps = 1/80 (1%) Frame = +2 Query: 260 DDKKKTWS-LSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRR 436 DD+ ++ L +F++ + +G+G+F VY AR ++ +VALK + ++D++ + Sbjct: 13 DDEYAVYNCLGNFEIEKKIGRGQFSVVYKARCTANNQIVALKKIQIFDMMDAKARQDCIK 72 Query: 437 EVEIQCRLRHPNILRMYGYF 496 E+++ +L HPN+++ Y F Sbjct: 73 EIDLLKQLNHPNVIKYYASF 92 >SB_9887| Best HMM Match : Pkinase (HMM E-Value=4.1e-37) Length = 256 Score = 48.8 bits (111), Expect = 3e-06 Identities = 24/79 (30%), Positives = 44/79 (55%) Frame = +2 Query: 266 KKKTWSLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVE 445 K+ DFD + +G+G FG V L +++++ +V A+K+L K+ +L+ E R E + Sbjct: 41 KRSRIGKEDFDSLKVIGRGAFGEVRLVQKQDTGHVYAMKILRKADMLEKEQVAHARAERD 100 Query: 446 IQCRLRHPNILRMYGYFHD 502 I + +++MY F D Sbjct: 101 ILAEAENQWVVKMYYSFQD 119 >SB_5192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 4865 Score = 48.8 bits (111), Expect = 3e-06 Identities = 23/70 (32%), Positives = 40/70 (57%) Frame = +2 Query: 293 FDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPN 472 F + R +GKG FG V + ++K++ + A+K + KS + + V RE+EI + HP Sbjct: 4111 FQILRAIGKGAFGKVCIVQKKDTKAMYAMKYMNKSACIKKDAVRNVLRELEILQTIEHPF 4170 Query: 473 ILRMYGYFHD 502 I+ ++ F D Sbjct: 4171 IVNLWFSFQD 4180 >SB_25040| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 456 Score = 48.8 bits (111), Expect = 3e-06 Identities = 26/76 (34%), Positives = 38/76 (50%), Gaps = 1/76 (1%) Frame = +2 Query: 272 KTWSLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQIL-DSEIEHQVRREVEI 448 K W + DF L + LGKG FG V L KE+ A+K L K +L D ++E + + Sbjct: 280 KQWHIEDFSLLKVLGKGSFGKVLLCELKETKEFFAIKALKKDVVLEDDDVECTMVERRVL 339 Query: 449 QCRLRHPNILRMYGYF 496 RHP + ++ F Sbjct: 340 ALATRHPFLTHLHSAF 355 >SB_59029| Best HMM Match : Pkinase (HMM E-Value=0) Length = 1023 Score = 46.4 bits (105), Expect = 1e-05 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 1/68 (1%) Frame = +2 Query: 302 GRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEH-QVRREVEIQCRLRHPNIL 478 GR LGKG F VY + ++ + ALKV+ K ++ S E+ ++ E+E+ LRH ++ Sbjct: 435 GRLLGKGGFARVYEVTDMSTNKIYALKVVPKKRLSKSTKEYRKIEMEIELHRTLRHHYVV 494 Query: 479 RMYGYFHD 502 +G F D Sbjct: 495 GFHGSFQD 502 >SB_29733| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 360 Score = 46.4 bits (105), Expect = 1e-05 Identities = 25/69 (36%), Positives = 39/69 (56%), Gaps = 1/69 (1%) Frame = +2 Query: 284 LSDFDL-GRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRL 460 + +DL G LGKG F V LA + + VA+KV+ +I D ++ + RE + R Sbjct: 12 IGTYDLSGTRLGKGNFAFVELAFNRVTKSKVAVKVIDTRKIKDDYVKRNILREALLLKRA 71 Query: 461 RHPNILRMY 487 HPNI+++Y Sbjct: 72 HHPNIVKLY 80 >SB_26666| Best HMM Match : Pkinase (HMM E-Value=3.7e-38) Length = 1215 Score = 46.4 bits (105), Expect = 1e-05 Identities = 22/65 (33%), Positives = 43/65 (66%) Frame = +2 Query: 293 FDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPN 472 +++ + +GKG F V LA + VA+K++ KSQ+ D + +V+REV++ +L HP+ Sbjct: 20 YNIEKTIGKGNFAVVKLATHCITKSKVAVKIIDKSQLDDDNLT-KVKREVKVMKKLAHPH 78 Query: 473 ILRMY 487 I++++ Sbjct: 79 IIKLH 83 >SB_33125| Best HMM Match : Pkinase (HMM E-Value=0) Length = 937 Score = 46.0 bits (104), Expect = 2e-05 Identities = 24/65 (36%), Positives = 41/65 (63%) Frame = +2 Query: 293 FDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPN 472 + L + +GKG F V LA+ + VA+K++ K+Q+ S ++ ++ REV I L HPN Sbjct: 83 YRLIKTIGKGNFAKVKLAKHVPTGKEVAIKIIDKTQLNPSSLQ-KLFREVRIMKFLDHPN 141 Query: 473 ILRMY 487 I+++Y Sbjct: 142 IVKLY 146 >SB_47948| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 641 Score = 45.2 bits (102), Expect = 3e-05 Identities = 20/67 (29%), Positives = 38/67 (56%) Frame = +2 Query: 302 GRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILR 481 G+ LGKG F Y + +++ + A K++ KS + + ++ E+EI ++ H +I+ Sbjct: 43 GKFLGKGGFAKCYELTDLDTNKIYAGKIISKSMLTKPHQKEKMAMEIEIHGKVMHKHIVG 102 Query: 482 MYGYFHD 502 +GYF D Sbjct: 103 FHGYFED 109 >SB_12255| Best HMM Match : Pkinase (HMM E-Value=0) Length = 476 Score = 45.2 bits (102), Expect = 3e-05 Identities = 22/65 (33%), Positives = 36/65 (55%) Frame = +2 Query: 293 FDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPN 472 ++L LGKG F V +E+ A+K+L + ++ H+V RE I LRHPN Sbjct: 17 YELKEELGKGAFSTVRKCCHRETKIEYAVKILDTKNMTQRDV-HKVEREARICRHLRHPN 75 Query: 473 ILRMY 487 ++R++ Sbjct: 76 VVRLH 80 >SB_35776| Best HMM Match : Pkinase (HMM E-Value=0) Length = 558 Score = 44.4 bits (100), Expect = 5e-05 Identities = 25/79 (31%), Positives = 40/79 (50%) Frame = +2 Query: 266 KKKTWSLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVE 445 ++ + S +DF++ +G+G FG V + ++K + V A+K L KSQ L E E E Sbjct: 72 RRLSLSKNDFNVVNTIGRGHFGEVQVVKDKATGDVYAMKTLKKSQTLSEEAVAFFEEERE 131 Query: 446 IQCRLRHPNILRMYGYFHD 502 I +P I + F D Sbjct: 132 IMATANNPWITSLQYAFQD 150 >SB_42686| Best HMM Match : Pkinase (HMM E-Value=0) Length = 759 Score = 43.6 bits (98), Expect = 9e-05 Identities = 27/100 (27%), Positives = 50/100 (50%) Frame = +2 Query: 188 RPLCSKANASEQQRADFFKT*IERDDKKKTWSLSDFDLGRPLGKGKFGNVYLAREKESHY 367 +P+ K +S++ + + R K+ + +F G+ LG G F V ++K + Sbjct: 414 KPIVKKKRSSKESSSGLEEEQYSRVTDKEVTDVYNF--GQKLGDGNFAIVRQCKDKITQK 471 Query: 368 VVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMY 487 A+K++ K +I E + E+ I R RHPNI+R++ Sbjct: 472 EFAIKIIDKRKIRGKE--KMIDDEIAIMRRCRHPNIVRLF 509 >SB_8759| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1184 Score = 43.2 bits (97), Expect = 1e-04 Identities = 22/79 (27%), Positives = 42/79 (53%) Frame = +2 Query: 266 KKKTWSLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVE 445 K+ +S F+ R +G G FG V+L R+ ++ + A+K+L KS++ V+ E + Sbjct: 647 KRTKMDISMFEKIRTIGIGAFGEVWLVRKTDTSMLYAMKILRKSEVFRRNQAAHVKAERD 706 Query: 446 IQCRLRHPNILRMYGYFHD 502 I + ++++Y F D Sbjct: 707 ILAEADNEWVVKLYYSFQD 725 >SB_31780| Best HMM Match : Pkinase (HMM E-Value=0) Length = 964 Score = 43.2 bits (97), Expect = 1e-04 Identities = 20/71 (28%), Positives = 38/71 (53%) Frame = +2 Query: 284 LSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLR 463 + +++ R +G+G +G VYL R +++V +K + ++ E EV++ + Sbjct: 1 MQNYEKVRIVGRGAYGTVYLCRRLVDNFLVIIKQIPVEEMTKEE-RQSALNEVKVLSMFQ 59 Query: 464 HPNILRMYGYF 496 HPNI+R Y F Sbjct: 60 HPNIIRYYDSF 70 >SB_8000| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 937 Score = 43.2 bits (97), Expect = 1e-04 Identities = 24/73 (32%), Positives = 37/73 (50%), Gaps = 1/73 (1%) Frame = +2 Query: 281 SLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQIL-DSEIEHQVRREVEIQCR 457 +L DF + LGKG FG V LA K + V A+K+L K +L D ++E + + Sbjct: 272 TLKDFTFIKVLGKGSFGKVLLAERKGTDEVYAIKILKKESVLQDDDVECTMIERRVLALS 331 Query: 458 LRHPNILRMYGYF 496 HP + ++ F Sbjct: 332 AGHPFLTSLHSSF 344 >SB_54232| Best HMM Match : Pkinase (HMM E-Value=1.1e-39) Length = 1123 Score = 42.7 bits (96), Expect = 2e-04 Identities = 23/64 (35%), Positives = 35/64 (54%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMYG 490 +GKG FG+ +L ++S + ALK L + + SE H EV+I L+H NI+R Sbjct: 10 IGKGTFGSAWLVESRQSKRLYALKEL-NATAMPSEDRHLALNEVKILSTLKHRNIVRYRD 68 Query: 491 YFHD 502 F + Sbjct: 69 AFEE 72 >SB_23777| Best HMM Match : Pkinase (HMM E-Value=0.065) Length = 97 Score = 42.7 bits (96), Expect = 2e-04 Identities = 23/66 (34%), Positives = 41/66 (62%) Frame = +2 Query: 299 LGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNIL 478 LG+ +G+G +G V+ R KE+ +VA+K +S+ D I+ REV++ +L+HPN++ Sbjct: 7 LGK-IGEGSYGVVFKCRHKETGQIVAIKKFVESED-DPLIKKIAMREVKMLKQLKHPNLV 64 Query: 479 RMYGYF 496 + F Sbjct: 65 NLLEVF 70 >SB_17071| Best HMM Match : Pkinase (HMM E-Value=0.065) Length = 97 Score = 42.7 bits (96), Expect = 2e-04 Identities = 23/66 (34%), Positives = 41/66 (62%) Frame = +2 Query: 299 LGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNIL 478 LG+ +G+G +G V+ R KE+ +VA+K +S+ D I+ REV++ +L+HPN++ Sbjct: 7 LGK-IGEGSYGVVFKCRHKETGQIVAIKKFVESED-DPLIKKIAMREVKMLKQLKHPNLV 64 Query: 479 RMYGYF 496 + F Sbjct: 65 NLLEVF 70 >SB_33716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 922 Score = 41.5 bits (93), Expect = 4e-04 Identities = 24/70 (34%), Positives = 40/70 (57%), Gaps = 4/70 (5%) Frame = +2 Query: 305 RPLGKGKFGNVYLAREKESHYVVALKVLFKSQIL-DSEIEH---QVRREVEIQCRLRHPN 472 + +GKG FG V +AR + V +K + K++IL D +E V E+ + +L+HPN Sbjct: 590 KSIGKGAFGFVQMARRRADMSEVVVKFIRKAKILPDCWVEGPMGNVPLEIALLAKLKHPN 649 Query: 473 ILRMYGYFHD 502 I++M F + Sbjct: 650 IVKMLDAFEN 659 >SB_51111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 428 Score = 41.1 bits (92), Expect = 5e-04 Identities = 21/59 (35%), Positives = 34/59 (57%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMY 487 LG G F V + + + VA+K+L K++ LD + + + RE+ L HPNI+R+Y Sbjct: 67 LGTGNFCQVKMGIQSLTREKVAIKILDKTK-LDQKTQRLLSREISSMENLHHPNIIRLY 124 >SB_37880| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 314 Score = 40.3 bits (90), Expect = 9e-04 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 1/65 (1%) Frame = +2 Query: 305 RPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEH-QVRREVEIQCRLRHPNILR 481 RP+ +G FG V LA K + + A+K++ K Q S + H ++ EV I L HP I+ Sbjct: 54 RPIPRGAFGEVRLAFTKGTCHKFAVKLISKRQFSVSPVSHASIKDEVNILKALNHPCIIE 113 Query: 482 MYGYF 496 + F Sbjct: 114 IADVF 118 >SB_24054| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 278 Score = 40.3 bits (90), Expect = 9e-04 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 2/70 (2%) Frame = +2 Query: 293 FDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQI-LDSEIEH-QVRREVEIQCRLRH 466 ++L +G+G F VY VA+KV+ K+ + E+E V EV + L H Sbjct: 140 YELLHLIGRGGFAMVYAGTRVRDGKPVAIKVIPKNNVYFFEEVEGISVPMEVYLHRVLDH 199 Query: 467 PNILRMYGYF 496 PN++R+Y YF Sbjct: 200 PNVVRLYDYF 209 >SB_11202| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1822 Score = 40.3 bits (90), Expect = 9e-04 Identities = 23/67 (34%), Positives = 37/67 (55%) Frame = +2 Query: 287 SDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRH 466 S+F+ LGKG FGNV R K + A+K + + + + ++ REV++ RL H Sbjct: 582 SEFEQLEFLGKGGFGNVIKVRNKLDGGLYAIKRIPWNP-KSTALNRKITREVQLISRLNH 640 Query: 467 PNILRMY 487 N++R Y Sbjct: 641 ENVVRYY 647 >SB_20101| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 161 Score = 39.9 bits (89), Expect = 0.001 Identities = 25/85 (29%), Positives = 46/85 (54%), Gaps = 3/85 (3%) Frame = +2 Query: 251 IERDDKKK--TWSLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILD-SEIE 421 I++ DK T +L DF+ + LG G FG V L + K S A+K+L K +++ ++E Sbjct: 27 IQKWDKPSHNTAALEDFERIKTLGTGSFGRVMLVQHKTSSKYFAMKILDKQKVVKLKQVE 86 Query: 422 HQVRREVEIQCRLRHPNILRMYGYF 496 H + + +Q + P ++ + +F Sbjct: 87 HTLNEKRILQA-ISFPFLVSLEWHF 110 >SB_15979| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 39.9 bits (89), Expect = 0.001 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 1/73 (1%) Frame = +2 Query: 281 SLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRL 460 S+S+F+ R +GKG +G L R+K+ +V LK + + +E E ++ +L Sbjct: 24 SISNFEKIRTVGKGAYGAAVLYRKKDDDSLVILKEITLHDLTGAE-RQMAMNEAKVLSKL 82 Query: 461 R-HPNILRMYGYF 496 HPNI+ Y F Sbjct: 83 SLHPNIISYYDSF 95 >SB_13192| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 39.5 bits (88), Expect = 0.002 Identities = 22/64 (34%), Positives = 35/64 (54%), Gaps = 1/64 (1%) Frame = +2 Query: 314 GKGKFGNVYLAREKESHYVVALKVLFKSQILD-SEIEHQVRREVEIQCRLRHPNILRMYG 490 G G FG V LAR++ ALK++ S+++ ++EH V+ E I + HP I+ + Sbjct: 48 GTGTFGRVLLARDRRGGEFYALKIMNISEVIRLKQVEH-VQNEKNILMSIEHPFIVNLLW 106 Query: 491 YFHD 502 HD Sbjct: 107 TQHD 110 >SB_22883| Best HMM Match : Pkinase (HMM E-Value=6.4e-12) Length = 326 Score = 39.1 bits (87), Expect = 0.002 Identities = 21/69 (30%), Positives = 38/69 (55%), Gaps = 1/69 (1%) Frame = +2 Query: 299 LGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILD-SEIEHQVRREVEIQCRLRHPNI 475 +G LG+G +G V + E+ A+K+L K ++ E V+RE+ + RL H N+ Sbjct: 72 MGDMLGEGSYGKVKEMLDCENLRRCAVKILKKRRLRRIPNGEQNVKREIRLLKRLNHKNV 131 Query: 476 LRMYGYFHD 502 +++Y +D Sbjct: 132 IQLYDVIYD 140 >SB_51685| Best HMM Match : Pkinase (HMM E-Value=0) Length = 380 Score = 39.1 bits (87), Expect = 0.002 Identities = 22/67 (32%), Positives = 39/67 (58%) Frame = +2 Query: 284 LSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLR 463 +++F+ +G+G +G VY A++ +S +VALK + Q D I RE+ + LR Sbjct: 33 VAEFEKLNRIGEGTYGIVYRAKDTKSGKIVALKKVRMEQERDG-IPISGLREITLLLNLR 91 Query: 464 HPNILRM 484 H NI+++ Sbjct: 92 HENIVQL 98 >SB_44532| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 414 Score = 38.3 bits (85), Expect = 0.004 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = +2 Query: 281 SLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRL 460 S+ DF +G+G +G VY A+ ++ ALK + + ++ D I RE+ + L Sbjct: 107 SMDDFSKIEKIGEGTYGVVYKAKNLKTGGFAALKKI-RLEVEDEGIPSTAVREISLLKEL 165 Query: 461 R-HPNILRMYGYFH 499 R HPN++ + H Sbjct: 166 RHHPNVVELQHILH 179 >SB_38533| Best HMM Match : Pkinase (HMM E-Value=0.15) Length = 116 Score = 38.3 bits (85), Expect = 0.004 Identities = 22/74 (29%), Positives = 38/74 (51%), Gaps = 1/74 (1%) Frame = +2 Query: 281 SLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRL 460 S+ DF +G+G +G VY A+ ++ ALK + + ++ D I RE+ + L Sbjct: 11 SMDDFSKIEKIGEGTYGVVYKAKNLKTGGFAALKKI-RLEVEDEGIPSTAVREISLLKEL 69 Query: 461 R-HPNILRMYGYFH 499 R HPN++ + H Sbjct: 70 RHHPNVVELQHILH 83 >SB_34306| Best HMM Match : Pkinase (HMM E-Value=0) Length = 367 Score = 37.9 bits (84), Expect = 0.005 Identities = 21/59 (35%), Positives = 29/59 (49%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMY 487 LGKG VYLA + VA+KVL + D + +E I L HP+I+ +Y Sbjct: 17 LGKGGMAEVYLATQASLQRKVAIKVLLSAD--DQAFSQRFLKEGHIVASLHHPSIITIY 73 >SB_4962| Best HMM Match : FAD_binding_4 (HMM E-Value=5.7e-31) Length = 916 Score = 37.9 bits (84), Expect = 0.005 Identities = 19/74 (25%), Positives = 42/74 (56%) Frame = +2 Query: 281 SLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRL 460 ++ + L LG+G+ G V L ++ VA+K++ +++ L ++ +V RE+ I + Sbjct: 8 TVGPYILQETLGRGQTGVVKLGVHCQTRKKVAVKIIDRTK-LSEQVLTKVEREIAIMKLI 66 Query: 461 RHPNILRMYGYFHD 502 HP++L +Y + + Sbjct: 67 EHPHVLGLYDVYEN 80 >SB_42409| Best HMM Match : Pkinase (HMM E-Value=6.7e-24) Length = 465 Score = 37.5 bits (83), Expect = 0.006 Identities = 18/39 (46%), Positives = 25/39 (64%) Frame = +2 Query: 287 SDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQI 403 SDF + +GKG FG V+L++ K+ A+KVL KS I Sbjct: 187 SDFLFLKVIGKGSFGKVFLSKNKQEDKFYAIKVLNKSAI 225 >SB_18299| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 698 Score = 37.5 bits (83), Expect = 0.006 Identities = 20/74 (27%), Positives = 42/74 (56%), Gaps = 1/74 (1%) Frame = +2 Query: 266 KKKTWSLSDF-DLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREV 442 KK+ S+ F +G+ +G G F V + ++++ ALK++ K+++ EH + E+ Sbjct: 10 KKRRVSVHGFYRIGKVIGDGNFAVVRECKHRKTNKEYALKIINKAKVKGK--EHMIENEI 67 Query: 443 EIQCRLRHPNILRM 484 I R++H +I+ + Sbjct: 68 SILRRVKHNHIVEL 81 >SB_6976| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 37.5 bits (83), Expect = 0.006 Identities = 23/69 (33%), Positives = 35/69 (50%) Frame = +2 Query: 293 FDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPN 472 ++L LGKG F V KES A K++ ++ L S ++ RE I L+HPN Sbjct: 13 YELKEELGKGAFSIVRRCIHKESRIEYAAKII-NTRKLSSRDLQKLDREARICRLLKHPN 71 Query: 473 ILRMYGYFH 499 I+ + +H Sbjct: 72 IVVKFTCYH 80 >SB_3515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1295 Score = 37.5 bits (83), Expect = 0.006 Identities = 22/70 (31%), Positives = 33/70 (47%) Frame = +2 Query: 290 DFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHP 469 D +G +G+G FG V K + V+ LK L D E + +EV + L+HP Sbjct: 945 DLIVGEVIGRGFFGQVMKVTHKTTGEVMVLKELIN---YDDEAKAGFLKEVALLKSLQHP 1001 Query: 470 NILRMYGYFH 499 N+L G + Sbjct: 1002 NVLHFIGILY 1011 >SB_30262| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 453 Score = 37.1 bits (82), Expect = 0.008 Identities = 26/86 (30%), Positives = 45/86 (52%), Gaps = 5/86 (5%) Frame = +2 Query: 254 ERDDKKKTWSLSDFDLGRPLGKGKFGNVYLAREKESHY---VVALKVLFKSQILD--SEI 418 E D+K + +F+L R LG G +G V+LAR++ H+ + A+KVL K+ I+ Sbjct: 23 EAQDEKV--GIENFELLRVLGTGAYGKVFLARKRGGHHDGRLFAMKVLKKATIVQKAKTA 80 Query: 419 EHQVRREVEIQCRLRHPNILRMYGYF 496 EH ++ R P ++ ++ F Sbjct: 81 EHTRTERQVLEAVRRCPFLVTLHWAF 106 >SB_17501| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 819 Score = 37.1 bits (82), Expect = 0.008 Identities = 22/62 (35%), Positives = 36/62 (58%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMYG 490 LG G+FG VY ++S VA+KV+ K + ++ E Q++ EV I +L HP ++ + Sbjct: 530 LGSGQFGIVYGGVHRQSGREVAVKVIDKLR-FPTKQEAQLKNEVAILKQLNHPGMVTLEQ 588 Query: 491 YF 496 F Sbjct: 589 MF 590 >SB_57764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 462 Score = 36.7 bits (81), Expect = 0.011 Identities = 19/60 (31%), Positives = 36/60 (60%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMYG 490 +G+G FG VY A + VA+KV+ ++ ++ + ++ EV + +RHPNI+++ G Sbjct: 271 IGRGAFGTVYKATWAGTP--VAVKVI---RVRNASVSSELENEVAVHSLVRHPNIIQIMG 325 >SB_21476| Best HMM Match : Pkinase_C (HMM E-Value=0.001) Length = 257 Score = 36.7 bits (81), Expect = 0.011 Identities = 22/70 (31%), Positives = 35/70 (50%), Gaps = 3/70 (4%) Frame = +2 Query: 293 FDLGRPLGKGKFGNVYLAREKESH---YVVALKVLFKSQILDSEIEHQVRREVEIQCRLR 463 F+L + LGKG +G V+L ++ H + A+KVL K I ++ + H +E Sbjct: 65 FELLKVLGKGGYGKVFLVKKNHGHSKEKIFAMKVLKKESIFENSLTHTFCGTIEYMA--- 121 Query: 464 HPNILRMYGY 493 P IL G+ Sbjct: 122 -PEILTRSGH 130 >SB_53036| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 745 Score = 36.3 bits (80), Expect = 0.014 Identities = 30/103 (29%), Positives = 41/103 (39%) Frame = +2 Query: 188 RPLCSKANASEQQRADFFKT*IERDDKKKTWSLSDFDLGRPLGKGKFGNVYLAREKESHY 367 R C A QR D + D ++ SD +G+ LG G FG+VY A + Sbjct: 8 RLFCESAEVCSCQRRDKLYCALTSGD----FAFSDLKVGKLLGSGGFGSVYEASYRGER- 62 Query: 368 VVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMYGYF 496 +ALK L K + E HPNI+R + F Sbjct: 63 -MALKRLHKETKNERAARESFEAETS-ALNFAHPNIVRTFTLF 103 >SB_13922| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1012 Score = 36.3 bits (80), Expect = 0.014 Identities = 24/68 (35%), Positives = 34/68 (50%) Frame = +2 Query: 284 LSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLR 463 L+DF+ LGKG FG V+ AR K A+K + E +V REV+ +L Sbjct: 448 LTDFEHELCLGKGGFGLVFQARNKVDDCQYAIKRVRLPNC--DEARAKVMREVKALAKLE 505 Query: 464 HPNILRMY 487 H I+R + Sbjct: 506 HSGIVRYF 513 >SB_58868| Best HMM Match : Pkinase (HMM E-Value=1.9e-32) Length = 434 Score = 35.9 bits (79), Expect = 0.019 Identities = 23/69 (33%), Positives = 39/69 (56%), Gaps = 3/69 (4%) Frame = +2 Query: 287 SDFDLGRPLGKGKFGNVYLARE---KESHYVVALKVLFKSQILDSEIEHQVRREVEIQCR 457 S F+L + LG+G FG V+L R+ ++ + A+KVL K L + +E +I Sbjct: 27 SQFELLKVLGQGSFGKVFLVRKVIGADAGTLYAMKVL-KKATLKVRDRMRTMKERDILVD 85 Query: 458 LRHPNILRM 484 ++HP I+R+ Sbjct: 86 VQHPFIVRL 94 >SB_40213| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.1e-07) Length = 750 Score = 35.9 bits (79), Expect = 0.019 Identities = 25/60 (41%), Positives = 32/60 (53%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMYG 490 LG G +G VY A K VA+KV K+ D +R+EV RLRHP+I+ M G Sbjct: 265 LGDGGYGTVYKA--KYYGQFVAVKVFRKAT--DVCPHRLLRQEVPFLSRLRHPSIINMIG 320 >SB_36849| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 634 Score = 35.5 bits (78), Expect = 0.025 Identities = 22/63 (34%), Positives = 37/63 (58%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMYG 490 +G G FG VY AR +S +VA+K + + D ++ RE++I +L H NI+R+ Sbjct: 37 IGNGSFGVVYQARMCDSTELVAIKKVLQ----DKRFKN---RELQIMRKLDHCNIVRLRW 89 Query: 491 YFH 499 +F+ Sbjct: 90 FFY 92 >SB_9978| Best HMM Match : Pkinase (HMM E-Value=3.4e-17) Length = 348 Score = 35.5 bits (78), Expect = 0.025 Identities = 22/75 (29%), Positives = 37/75 (49%), Gaps = 3/75 (4%) Frame = +2 Query: 281 SLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEI---Q 451 S+S+F LG+G FG LA + ++ + A+K L K I+ E + E I Sbjct: 168 SMSNFRCISVLGRGHFGKAILAEYRTTNELFAIKALKKGDIIAREEVESLLAEKRIFLTA 227 Query: 452 CRLRHPNILRMYGYF 496 + RHP ++ ++ F Sbjct: 228 NKTRHPFLVNLFACF 242 >SB_55249| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 443 Score = 35.1 bits (77), Expect = 0.033 Identities = 18/58 (31%), Positives = 34/58 (58%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRM 484 +G+G FG VY A + V + + ++ + SE+E+ EV + C +R+PNI+++ Sbjct: 304 IGRGAFGTVYKATWAGTPVAVKVIRVRNARSVSSELEN----EVSVHCLVRYPNIIQL 357 >SB_36661| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 463 Score = 34.7 bits (76), Expect = 0.044 Identities = 31/111 (27%), Positives = 52/111 (46%), Gaps = 3/111 (2%) Frame = +2 Query: 179 PSSRPLCSKANASEQQRADFFKT*IERDDKKKTWSLSD-FDLGR-PLGKGKFGNVYLARE 352 P + A SE+ +A K +R++ + D + L PLG+GK G V+ Sbjct: 57 PPPDDIFQPAPLSEEDKAAKKKRKKKRNNNSSSAGFHDIYKLTEEPLGQGKKGVVHGCIN 116 Query: 353 KESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLR-HPNILRMYGYFHD 502 ++ A+K++ KS ++ ++ E+E+ R R H NIL YF D Sbjct: 117 TITNLEYAVKIIQKSPTVE---RRRILNEIELLYRCRGHRNILECIEYFED 164 >SB_14304| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1219 Score = 34.7 bits (76), Expect = 0.044 Identities = 18/64 (28%), Positives = 34/64 (53%) Frame = +2 Query: 293 FDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPN 472 ++LG LGKG + V A + VA+K++ K+++ +RREVE ++ H Sbjct: 69 YELGSILGKGAYAEVKEAYSNKLGRNVAVKIIEKAKLSSKSFNKFMRREVEALRQVDHKY 128 Query: 473 ILRM 484 ++ + Sbjct: 129 VISL 132 >SB_9807| Best HMM Match : Pkinase_Tyr (HMM E-Value=0.00031) Length = 310 Score = 34.7 bits (76), Expect = 0.044 Identities = 20/66 (30%), Positives = 37/66 (56%), Gaps = 3/66 (4%) Frame = +2 Query: 302 GRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRR---EVEIQCRLRHPN 472 G+ LG G FG VY+ + ++ +A+K + Q L+S +++V+ E+E R+ Sbjct: 193 GKLLGAGAFGQVYMCHDLDTGRELAVKQIETGQ-LNSSTKNEVKALEGEIEFMKAFRNER 251 Query: 473 ILRMYG 490 I++ YG Sbjct: 252 IVQYYG 257 >SB_8812| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 604 Score = 34.7 bits (76), Expect = 0.044 Identities = 15/51 (29%), Positives = 30/51 (58%), Gaps = 1/51 (1%) Frame = +2 Query: 350 EKESHYVVALKVLFKSQILDSEIEHQVRREVE-IQCRLRHPNILRMYGYFH 499 + + H +VA+KV+ K Q ++ + RE++ + RH N++++Y FH Sbjct: 71 DSKGHNMVAIKVVSKKQAPTEYLQKFMPREIDALNATCRHHNVIQLYETFH 121 >SB_40460| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 831 Score = 34.7 bits (76), Expect = 0.044 Identities = 22/63 (34%), Positives = 33/63 (52%), Gaps = 3/63 (4%) Frame = +2 Query: 311 LGKGKFGNVYLAR---EKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILR 481 +G+G F NV L + + VA+K + K L+ +E V RE + L H NI+R Sbjct: 46 IGEGFFANVALGKWIGPNKREQFVAIKSI-KGNFLEDHLE-DVLREADTMMSLDHRNIIR 103 Query: 482 MYG 490 +YG Sbjct: 104 LYG 106 >SB_59557| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1109 Score = 34.3 bits (75), Expect = 0.058 Identities = 22/68 (32%), Positives = 35/68 (51%) Frame = +2 Query: 281 SLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRL 460 ++ +F + +G +G VY A+EK S VVALK L K + RE+ + Sbjct: 590 NVEEFQWLNRIEEGTYGVVYRAKEKASGEVVALKRL-KMEKEKEGFPITSLREINTLLKA 648 Query: 461 RHPNILRM 484 +HPNI+ + Sbjct: 649 QHPNIVHV 656 >SB_36983| Best HMM Match : Pkinase (HMM E-Value=6.4e-22) Length = 331 Score = 34.3 bits (75), Expect = 0.058 Identities = 24/66 (36%), Positives = 37/66 (56%), Gaps = 1/66 (1%) Frame = +2 Query: 293 FDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVR-REVEIQCRLRHP 469 ++L LG+G G VY R K+S VVA+K S L +VR RE ++ +L H Sbjct: 11 WNLKSVLGQGATGAVYTGRHKKSGDVVAVKT---SNHLGMMRPLEVRKREFDVLSKLDHE 67 Query: 470 NILRMY 487 NI++++ Sbjct: 68 NIVKIF 73 >SB_33752| Best HMM Match : I-set (HMM E-Value=3.7e-15) Length = 783 Score = 33.9 bits (74), Expect = 0.077 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +2 Query: 317 KGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNIL 478 +GKFG V +K++ V A K + S L V RE++I R+ H ++ Sbjct: 6 RGKFGVVKRVTDKKTGTVYAAKYIKTSGALSGSSRDDVMREIDIMSRMHHKRLV 59 Score = 32.7 bits (71), Expect = 0.18 Identities = 24/82 (29%), Positives = 39/82 (47%), Gaps = 1/82 (1%) Frame = +2 Query: 254 ERDDKKKTWSLSDF-DLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQV 430 E+ K + + DF L +G+G+FG V K H A+ + KS + + Sbjct: 439 EKVVKLRKEHIEDFYALEEEVGRGRFGVV----RKCVHLKTAVHFVAKSIKARPSQKEEF 494 Query: 431 RREVEIQCRLRHPNILRMYGYF 496 RE+++ LRHPN+ R+ F Sbjct: 495 SREIDVMNELRHPNLSRIRDAF 516 >SB_11825| Best HMM Match : Pkinase (HMM E-Value=1.2e-17) Length = 181 Score = 33.9 bits (74), Expect = 0.077 Identities = 17/54 (31%), Positives = 27/54 (50%) Frame = +2 Query: 317 KGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNIL 478 +GKFG V +K++ V A K + S L V RE++I R+ H ++ Sbjct: 6 RGKFGVVKRVTDKKTGTVYAAKYIKTSGALSGSSRDDVMREIDIMSRMHHKRLV 59 >SB_47182| Best HMM Match : Pkinase (HMM E-Value=1e-09) Length = 198 Score = 33.5 bits (73), Expect = 0.10 Identities = 15/30 (50%), Positives = 21/30 (70%) Frame = +2 Query: 293 FDLGRPLGKGKFGNVYLAREKESHYVVALK 382 FD+ LG+G +G+V+ A KES VVA+K Sbjct: 24 FDVLEKLGEGSYGSVFKAMHKESGQVVAIK 53 >SB_48846| Best HMM Match : Pkinase_Tyr (HMM E-Value=8.1e-16) Length = 523 Score = 33.1 bits (72), Expect = 0.13 Identities = 23/67 (34%), Positives = 38/67 (56%), Gaps = 3/67 (4%) Frame = +2 Query: 299 LGRPLGKGKFGNVYLA--REKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLR-HP 469 +G+ +GKG FG V+ A + K + +VA+K+L K + D+ E+E+ L HP Sbjct: 250 IGKVIGKGHFGKVHRAVMKTKSGNRIVAVKML-KDNV-DAVHMKDFLAELELMKSLAPHP 307 Query: 470 NILRMYG 490 NI+ + G Sbjct: 308 NIVCLLG 314 >SB_41076| Best HMM Match : Ras (HMM E-Value=1.90016e-42) Length = 704 Score = 33.1 bits (72), Expect = 0.13 Identities = 24/64 (37%), Positives = 36/64 (56%), Gaps = 6/64 (9%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKV--LFKSQILDSEI-EHQV---RREVEIQCRLRHPN 472 +GKG +G V+ AR K + V A ++ +F + E+ +H V RRE E+ L HPN Sbjct: 24 IGKGSYGEVWRARWKGT-CVAAKRIHNIFFERDYGQEVRDHYVQEFRREWEVLRTLEHPN 82 Query: 473 ILRM 484 I+ M Sbjct: 83 IVEM 86 >SB_31697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 518 Score = 33.1 bits (72), Expect = 0.13 Identities = 34/110 (30%), Positives = 51/110 (46%), Gaps = 3/110 (2%) Frame = +2 Query: 176 VPSSRPLCSKANA--SEQQRADFFKT*IERDDK-KKTWSLSDFDLGRPLGKGKFGNVYLA 346 VPS S A + SE++ D K + + D K +++ D LGKG+FG V Sbjct: 121 VPSDDESASDAESDISEEESEDEDKDVVLKSDAITKYYTIKD-----ELGKGRFGVVCKC 175 Query: 347 REKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMYGYF 496 K++ A K + S+ D E V E+EI +RH +LR+ F Sbjct: 176 VNKKTGKQFAAKFIKCSKPQDRE---DVIHEMEIMNTIRHKRLLRLADAF 222 >SB_31555| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1063 Score = 33.1 bits (72), Expect = 0.13 Identities = 18/77 (23%), Positives = 40/77 (51%), Gaps = 3/77 (3%) Frame = +2 Query: 263 DKKKTWSLSDFDLGRPLGKGKFGNVYLAR---EKESHYVVALKVLFKSQILDSEIEHQVR 433 +K + + L + + LG+G FG V+ R + + + V+ + V + E++ + Sbjct: 818 EKLQHYPLDRVEYVKDLGEGHFGKVFQGRANLQGKPNTVIPVAVKALKEGSSKELKEEFY 877 Query: 434 REVEIQCRLRHPNILRM 484 +EV + L HPN++++ Sbjct: 878 QEVALMSILDHPNVVKL 894 >SB_47579| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 316 Score = 32.7 bits (71), Expect = 0.18 Identities = 20/68 (29%), Positives = 35/68 (51%) Frame = +2 Query: 284 LSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLR 463 L D++ +G G +G R K+ + V+ L Q+ ++E + V EV + L+ Sbjct: 6 LHDYEELERIGSGSYGICKKIRRKKDNKVLVWMELDYGQMSETEKQMLVS-EVNLLRELK 64 Query: 464 HPNILRMY 487 HP+I+R Y Sbjct: 65 HPHIVRYY 72 >SB_32454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1161 Score = 32.7 bits (71), Expect = 0.18 Identities = 16/39 (41%), Positives = 24/39 (61%) Frame = +2 Query: 290 DFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQIL 406 DF+ +GKG FG V + R+K S + A+K L K ++L Sbjct: 77 DFEPICLIGKGAFGEVTVVRQKSSERIYAMKTLNKWEML 115 >SB_27678| Best HMM Match : Pkinase (HMM E-Value=0) Length = 641 Score = 32.7 bits (71), Expect = 0.18 Identities = 20/62 (32%), Positives = 35/62 (56%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMYG 490 LG+G F +VY + E+ VA L + + SE + R E E+ +L+HPNI++ + Sbjct: 86 LGRGSFKSVYQGLDTETGVAVAWCEL-QDKYSRSE-RARFREEAEMLKQLQHPNIVKFHD 143 Query: 491 YF 496 ++ Sbjct: 144 FW 145 >SB_29237| Best HMM Match : I-set (HMM E-Value=0) Length = 869 Score = 32.7 bits (71), Expect = 0.18 Identities = 21/76 (27%), Positives = 33/76 (43%), Gaps = 5/76 (6%) Frame = +2 Query: 290 DFDLGRPLGKGKFGNVYLAR-----EKESHYVVALKVLFKSQILDSEIEHQVRREVEIQC 454 D + R LG G +G +LAR + E +V +K L D + RE+E Sbjct: 767 DLEALRTLGNGSYGRAFLARASGIKDGERETMVVVKSLIAK---DDIVREDFTRELESLV 823 Query: 455 RLRHPNILRMYGYFHD 502 + H N++ + G D Sbjct: 824 NMEHSNVVSLLGVCRD 839 >SB_3739| Best HMM Match : Pkinase (HMM E-Value=0) Length = 490 Score = 32.7 bits (71), Expect = 0.18 Identities = 21/60 (35%), Positives = 30/60 (50%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMYG 490 +G+G G V LA +K + VA+K K + + + EV I HPNI+ MYG Sbjct: 224 IGEGSTGIVCLATDKRTGRQVAVK---KMDLKKQQRRELLFNEVVIMRDYPHPNIVEMYG 280 >SB_14271| Best HMM Match : Pkinase (HMM E-Value=2.1e-27) Length = 2056 Score = 32.3 bits (70), Expect = 0.23 Identities = 15/36 (41%), Positives = 24/36 (66%), Gaps = 2/36 (5%) Frame = +2 Query: 392 KSQILDSEIEHQVR--REVEIQCRLRHPNILRMYGY 493 K I+ ++H+VR RE++ +L+HPNIL +GY Sbjct: 228 KEFIVPISLKHKVRLKRELQFLKQLKHPNILHHFGY 263 >SB_18517| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 353 Score = 32.3 bits (70), Expect = 0.23 Identities = 20/78 (25%), Positives = 41/78 (52%) Frame = +2 Query: 254 ERDDKKKTWSLSDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVR 433 ER K++ + +G LG+G FG+V+ A + Y A+K + ++ ++ + Sbjct: 59 ERMAKRRKLIIKTLRIGSLLGRGGFGSVFEATLRGKKY--AVKQMHRTAKNPRAMQESME 116 Query: 434 REVEIQCRLRHPNILRMY 487 E ++ L+HPNI++ + Sbjct: 117 AE-KLILALKHPNIVQTF 133 >SB_31029| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 843 Score = 31.9 bits (69), Expect = 0.31 Identities = 14/37 (37%), Positives = 21/37 (56%) Frame = -1 Query: 495 KYPYMRKMFG*RSRHWISTSRRTWCSISESKIWLLKR 385 K Y +++ G +S W TS R W S+ K+W LK+ Sbjct: 165 KIKYGQRLAG-QSFRWHETSEREWRSVLRGKVWTLKQ 200 >SB_30712| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 105 Score = 31.9 bits (69), Expect = 0.31 Identities = 22/60 (36%), Positives = 32/60 (53%), Gaps = 1/60 (1%) Frame = +2 Query: 305 RPLGKGKFGNVYLAREKESHYVVALKVLFKSQI-LDSEIEHQVRREVEIQCRLRHPNILR 481 R +G G FG V L K + + LK K ++ L +Q ++EVEI L HPNI++ Sbjct: 19 RCVGTGSFGTVTLWENKITKEQIVLK---KCRLDLSPSNRNQWQKEVEIMKGLDHPNIVK 75 >SB_28695| Best HMM Match : Ras (HMM E-Value=0) Length = 1058 Score = 31.9 bits (69), Expect = 0.31 Identities = 19/69 (27%), Positives = 36/69 (52%), Gaps = 2/69 (2%) Frame = +2 Query: 290 DFDLGRPLGKGKFGNVYLAREKESHYVVALKV-LFKSQILDSEIEHQ-VRREVEIQCRLR 463 ++ G LGKG FG V+L + +V L + + +E +++ ++ EV + L+ Sbjct: 176 EWQKGNVLGKGAFGTVFLGLVNTGELIAVKQVELHPNNVDAAERQYEKLQEEVGLLKSLK 235 Query: 464 HPNILRMYG 490 H NI++ G Sbjct: 236 HKNIVQYIG 244 >SB_19269| Best HMM Match : Pkinase (HMM E-Value=2.4e-38) Length = 501 Score = 31.9 bits (69), Expect = 0.31 Identities = 18/64 (28%), Positives = 36/64 (56%) Frame = +2 Query: 293 FDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPN 472 ++ G+ LG+G FG V A+ E+ A+K + K + S ++ + REV I ++ H + Sbjct: 27 YEFGQVLGRGSFGVVNEAKHIETGTRWAIKAVNKEKAGSSAVK-LLEREVMIMKKIYHEH 85 Query: 473 ILRM 484 ++ + Sbjct: 86 LIHL 89 >SB_49877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 607 Score = 31.5 bits (68), Expect = 0.41 Identities = 21/63 (33%), Positives = 35/63 (55%), Gaps = 5/63 (7%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEH-----QVRREVEIQCRLRHPNI 475 LG+G +G V+ A+ + + +VA K L + + IE + RRE E+ L HPN+ Sbjct: 12 LGRGSYGVVHKAKYEGN--LVAAKRLHPTLLESGPIERGALLAKFRRECELLEALNHPNV 69 Query: 476 LRM 484 +R+ Sbjct: 70 VRL 72 >SB_54907| Best HMM Match : Pkinase (HMM E-Value=1.4e-10) Length = 251 Score = 30.7 bits (66), Expect = 0.71 Identities = 14/39 (35%), Positives = 23/39 (58%) Frame = +2 Query: 290 DFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQIL 406 DF + +G+G FG V L R + V A+K+L K +++ Sbjct: 71 DFKTLKVIGRGAFGEVQLVRHTHTKKVYAMKLLSKFEMV 109 >SB_42709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1616 Score = 30.7 bits (66), Expect = 0.71 Identities = 17/50 (34%), Positives = 31/50 (62%), Gaps = 2/50 (4%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEI--QC 454 +GKG FG V+ + ++ VVA+K++ + D EIE +++E+ + QC Sbjct: 818 IGKGSFGEVFKGIDNRTNEVVAIKIIDLEEAED-EIE-DIQQEITVLSQC 865 >SB_32519| Best HMM Match : Pkinase (HMM E-Value=7.3e-39) Length = 1486 Score = 30.7 bits (66), Expect = 0.71 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 1/39 (2%) Frame = +2 Query: 371 VALKVLFKSQIL-DSEIEHQVRREVEIQCRLRHPNILRM 484 VA+K++ K Q L D + +RRE I +RHP+I+ + Sbjct: 207 VAVKIIDKKQALEDRYVSKNMRREARILQMVRHPHIISL 245 >SB_6393| Best HMM Match : 7tm_1 (HMM E-Value=2.1e-28) Length = 307 Score = 30.7 bits (66), Expect = 0.71 Identities = 15/53 (28%), Positives = 27/53 (50%) Frame = -1 Query: 279 QVFFLSSRSIQVLKKSALCCSLAFAFEHKGREDGTAGILKLSVGIFGIFILHW 121 ++F + ++ L K +LC A +F+ K + + K+ I GIF+L W Sbjct: 174 RIFREVQKQVRKLAKISLCDQYAPSFKEKKKMASEVRVAKVFAVIAGIFVLSW 226 >SB_38378| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 478 Score = 30.7 bits (66), Expect = 0.71 Identities = 19/68 (27%), Positives = 33/68 (48%) Frame = +2 Query: 287 SDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRH 466 S+ LGR LG G+FG V +E + + V K + E E ++ + +H Sbjct: 212 SELTLGRELGAGQFGCV-----REGMWRGTIPVAVKMMKDGAMSEEDFIEEAKVMKQFQH 266 Query: 467 PNILRMYG 490 N++++YG Sbjct: 267 GNLVQLYG 274 >SB_42225| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 300 Score = 30.3 bits (65), Expect = 0.94 Identities = 18/66 (27%), Positives = 33/66 (50%), Gaps = 4/66 (6%) Frame = +2 Query: 305 RPLGKGKFGNVYLAR--EKESHYVVALKVLFKS--QILDSEIEHQVRREVEIQCRLRHPN 472 + LG+G +G VY K ++A VL S + + ++ + + E +L+HPN Sbjct: 25 KELGEGDYGKVYFGEITTKSEGRLMATSVLVVSLRESHEVDVRDEFFEKAEAWSKLQHPN 84 Query: 473 ILRMYG 490 I+ + G Sbjct: 85 IITIVG 90 >SB_36282| Best HMM Match : HHH (HMM E-Value=7.4) Length = 152 Score = 30.3 bits (65), Expect = 0.94 Identities = 14/40 (35%), Positives = 21/40 (52%) Frame = +2 Query: 263 DKKKTWSLSDFDLGRPLGKGKFGNVYLAREKESHYVVALK 382 D K +DF + +GKG FG+V + K + V A+K Sbjct: 80 DSKPPVKFTDFQILATIGKGAFGHVLQVQHKSTDEVFAMK 119 >SB_20713| Best HMM Match : Pkinase (HMM E-Value=0) Length = 492 Score = 29.9 bits (64), Expect = 1.2 Identities = 18/58 (31%), Positives = 29/58 (50%) Frame = +2 Query: 311 LGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRM 484 +G G G VY + ++ VALK + I D R++E+Q L H NI+++ Sbjct: 20 IGTGGSGAVYSGIDSKTDRRVALK---RVNIQDQSSCRTTLRQIEVQRNLEHENIVKL 74 >SB_4877| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 517 Score = 29.9 bits (64), Expect = 1.2 Identities = 15/39 (38%), Positives = 24/39 (61%), Gaps = 2/39 (5%) Frame = +2 Query: 383 VLFKSQILDSEIEHQVR--REVEIQCRLRHPNILRMYGY 493 V K I+ ++H+VR RE++ +++HPNIL GY Sbjct: 206 VACKEFIVPISLKHKVRLKRELQFLKQIKHPNILHHCGY 244 >SB_20885| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 29.5 bits (63), Expect = 1.6 Identities = 15/41 (36%), Positives = 19/41 (46%) Frame = -2 Query: 413 LNPRFGF*KEPSKRRHSEILFHGLSTHCRISLYRAVVLDRS 291 L F P R HSEI + G TH +I L +LD + Sbjct: 142 LKDAISFLLAPKARHHSEIQYDGNVTHLKIQLAAVKLLDNN 182 >SB_19785| Best HMM Match : SRR1 (HMM E-Value=8.8e-19) Length = 735 Score = 29.5 bits (63), Expect = 1.6 Identities = 13/26 (50%), Positives = 17/26 (65%) Frame = +2 Query: 305 RPLGKGKFGNVYLAREKESHYVVALK 382 R +G G FG VY AR ++ VVA+K Sbjct: 466 REIGHGSFGAVYYARNVRTNEVVAIK 491 >SB_47927| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) Length = 512 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/63 (26%), Positives = 25/63 (39%) Frame = +2 Query: 80 CKENRMQTAGRSACQCNINIPKMPTDSFKIPAVPSSRPLCSKANASEQQRADFFKT*IER 259 C E++ G + N PK K P + S C K N + + D F IE+ Sbjct: 341 CTEHKYCNKGDQVRKRKCNSPKPKDGGDKCPGLNSESIECPKENCIDVPKEDKFSKEIEK 400 Query: 260 DDK 268 D + Sbjct: 401 DSE 403 >SB_18127| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 963 Score = 29.1 bits (62), Expect = 2.2 Identities = 19/69 (27%), Positives = 30/69 (43%), Gaps = 2/69 (2%) Frame = +2 Query: 290 DFDLGRPLGKGKFGNVYLAR-EKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLR- 463 D D G+ LG G FG VY K+ + K + E + E+ I ++ Sbjct: 781 DVDFGKELGSGAFGEVYAGTVSKDGKCLPCAVKTLKRHATEREY-RDLFNELSIMGQVGF 839 Query: 464 HPNILRMYG 490 HPN++ + G Sbjct: 840 HPNVVNLIG 848 >SB_3163| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 29.1 bits (62), Expect = 2.2 Identities = 23/73 (31%), Positives = 33/73 (45%), Gaps = 3/73 (4%) Frame = +2 Query: 293 FDLGRPLGKGKFGNVYLAREKESHYVVALKVLFK--SQILDSEIE-HQVRREVEIQCRLR 463 FD+G +G G+F V EK S A K + K S+ L + Q+ RE + + Sbjct: 17 FDIGDEIGSGQFAVVKKCSEKSSGLEFAAKFMKKRRSKALRRGVTLEQIIREATVLRSVA 76 Query: 464 HPNILRMYGYFHD 502 H I+ Y HD Sbjct: 77 HQGII----YLHD 85 >SB_39250| Best HMM Match : TSP_1 (HMM E-Value=9.5e-34) Length = 468 Score = 29.1 bits (62), Expect = 2.2 Identities = 17/63 (26%), Positives = 25/63 (39%) Frame = +2 Query: 80 CKENRMQTAGRSACQCNINIPKMPTDSFKIPAVPSSRPLCSKANASEQQRADFFKT*IER 259 C E++ G + N PK K P + S C K N + + D F IE+ Sbjct: 297 CTEHKYCNKGDQVRKRKCNSPKPKDGGDKCPGLNSESIECPKENCIDVPKEDKFSKEIEK 356 Query: 260 DDK 268 D + Sbjct: 357 DSE 359 >SB_11865| Best HMM Match : Pkinase_Tyr (HMM E-Value=1.7e-07) Length = 184 Score = 29.1 bits (62), Expect = 2.2 Identities = 19/62 (30%), Positives = 31/62 (50%) Frame = +2 Query: 296 DLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNI 475 ++G+ LG G FG+V+ + + VA+K L + + + E I RHPNI Sbjct: 45 NIGKLLGSGGFGSVFEGKYRGKK--VAVKKLHVNSKNPRAVLQSFQAETSIM-SFRHPNI 101 Query: 476 LR 481 +R Sbjct: 102 VR 103 >SB_53713| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 903 Score = 28.7 bits (61), Expect = 2.9 Identities = 23/73 (31%), Positives = 38/73 (52%), Gaps = 4/73 (5%) Frame = +2 Query: 296 DLGRPLGKGKFGNVYLAREKE---SHYVVALKVLFKSQILDSEIEHQVRREVEIQCRL-R 463 +LGR LG+G+FG V E + A+K L K +S+ + + E++I ++ Sbjct: 631 ELGRTLGEGEFGKVIEGNVTEPDGTRVHCAVKKL-KRTATESDWK-DLLNELDIMVQVGE 688 Query: 464 HPNILRMYGYFHD 502 HPNI+ + G D Sbjct: 689 HPNIVNLIGACSD 701 >SB_35913| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 1176 Score = 28.7 bits (61), Expect = 2.9 Identities = 21/71 (29%), Positives = 34/71 (47%), Gaps = 6/71 (8%) Frame = +2 Query: 296 DLGRPLGKGKFGNVYLAREKESH-----YVVALKVLFKSQILDSEIEHQVRREVEIQCRL 460 D+G +G G FG V++A + H VA+K+L K + E E + E+ Sbjct: 809 DIGGQIGTGAFGTVFVADAYDIHGNEGPTTVAVKIL-KDNAREDEKE-DFKAEINFMKSF 866 Query: 461 -RHPNILRMYG 490 H N++R+ G Sbjct: 867 GEHENVIRIMG 877 >SB_33732| Best HMM Match : Pkinase (HMM E-Value=9e-10) Length = 322 Score = 27.9 bits (59), Expect = 5.0 Identities = 9/14 (64%), Positives = 13/14 (92%) Frame = +2 Query: 461 RHPNILRMYGYFHD 502 +H NILR++GYF+D Sbjct: 85 KHNNILRLFGYFYD 98 >SB_44172| Best HMM Match : Pkinase_Tyr (HMM E-Value=6.3e-20) Length = 637 Score = 27.5 bits (58), Expect = 6.6 Identities = 18/69 (26%), Positives = 30/69 (43%), Gaps = 2/69 (2%) Frame = +2 Query: 290 DFDLGRPLGKGKFGNVYLAR-EKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRLR- 463 D + G+ LG G FG VY K+ + K + E + E+ I ++ Sbjct: 443 DVEFGKELGSGAFGEVYAGTVSKDGKCLPCAVKTLKRHATEREY-RDLFNELSIMGQVGF 501 Query: 464 HPNILRMYG 490 HPN++ + G Sbjct: 502 HPNVVNLIG 510 >SB_27024| Best HMM Match : Pkinase (HMM E-Value=4.7e-25) Length = 1595 Score = 27.5 bits (58), Expect = 6.6 Identities = 9/21 (42%), Positives = 16/21 (76%) Frame = +2 Query: 428 VRREVEIQCRLRHPNILRMYG 490 +R+EV + C L+HP ++R+ G Sbjct: 423 LRQEVAVLCHLQHPCVVRLLG 443 >SB_57199| Best HMM Match : 7tm_1 (HMM E-Value=0) Length = 374 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/28 (46%), Positives = 17/28 (60%), Gaps = 1/28 (3%) Frame = -1 Query: 201 EHKGREDGTA-GILKLSVGIFGIFILHW 121 E + RED T GILK++V + F L W Sbjct: 235 EQRMREDATTRGILKMTVTVVAAFALSW 262 >SB_50960| Best HMM Match : Pkinase (HMM E-Value=0) Length = 632 Score = 27.5 bits (58), Expect = 6.6 Identities = 15/33 (45%), Positives = 19/33 (57%) Frame = +2 Query: 305 RPLGKGKFGNVYLAREKESHYVVALKVLFKSQI 403 R LGKG FG V + K S + A+K L K +I Sbjct: 89 RVLGKGGFGEVCACQSKISGKMYAMKKLEKKRI 121 >SB_8610| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 589 Score = 27.5 bits (58), Expect = 6.6 Identities = 13/33 (39%), Positives = 17/33 (51%) Frame = +2 Query: 140 PKMPTDSFKIPAVPSSRPLCSKANASEQQRADF 238 PK PT +P VPS P S+ N+ + A F Sbjct: 266 PKAPTALAILPVVPSGEPSTSEENSLNKAIASF 298 >SB_2736| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 40 Score = 27.5 bits (58), Expect = 6.6 Identities = 8/32 (25%), Positives = 20/32 (62%) Frame = +2 Query: 401 ILDSEIEHQVRREVEIQCRLRHPNILRMYGYF 496 ++D++ +E+++ +L HPN+++ Y F Sbjct: 4 MMDAKARQDCIKEIDLLKQLNHPNVIKYYASF 35 >SB_55640| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1071 Score = 27.1 bits (57), Expect = 8.8 Identities = 16/41 (39%), Positives = 22/41 (53%) Frame = -1 Query: 348 RAKYTLPNFPLPSGRPRSKSDRDQVFFLSSRSIQVLKKSAL 226 R+ +TLP P PSGR R D LS RS + + ++ L Sbjct: 225 RSPFTLPPSPPPSGRERRLPYMDVEGGLSGRSHRQVDETTL 265 >SB_34303| Best HMM Match : Pkinase (HMM E-Value=0) Length = 226 Score = 27.1 bits (57), Expect = 8.8 Identities = 19/67 (28%), Positives = 34/67 (50%), Gaps = 4/67 (5%) Frame = +2 Query: 311 LGKGKFGNVYLAREK-ESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRL---RHPNIL 478 +G G +G VY A++ VALK + + Q + + RE+ + ++ HPN++ Sbjct: 11 IGTGAYGTVYKAKDLLNDGKFVALKRV-RIQNSEEGMPLSTIREIALLKQIDNFAHPNVV 69 Query: 479 RMYGYFH 499 R+ FH Sbjct: 70 RLLDIFH 76 >SB_40820| Best HMM Match : Pkinase_Tyr (HMM E-Value=0) Length = 526 Score = 27.1 bits (57), Expect = 8.8 Identities = 23/72 (31%), Positives = 33/72 (45%), Gaps = 2/72 (2%) Frame = +2 Query: 269 KKTWSL--SDFDLGRPLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREV 442 K+ WS+ S+ + +GKG+FG+V L + VALK L D+ Q E Sbjct: 309 KEGWSIQKSELIIKETIGKGEFGDVLLGTYRGKQ--VALKCLKD----DTRAAQQFLAEA 362 Query: 443 EIQCRLRHPNIL 478 I L N+L Sbjct: 363 SIMTDLAARNVL 374 >SB_33829| Best HMM Match : Pkinase (HMM E-Value=0) Length = 290 Score = 27.1 bits (57), Expect = 8.8 Identities = 10/39 (25%), Positives = 23/39 (58%) Frame = +2 Query: 371 VALKVLFKSQILDSEIEHQVRREVEIQCRLRHPNILRMY 487 VA+K++ K + D + + RE+++ L H N++ ++ Sbjct: 18 VAVKIVTKKKAPDDYLTKFLPREIQVMKHLNHSNVVSLH 56 >SB_45| Best HMM Match : Pkinase (HMM E-Value=0) Length = 851 Score = 27.1 bits (57), Expect = 8.8 Identities = 19/66 (28%), Positives = 32/66 (48%), Gaps = 1/66 (1%) Frame = +2 Query: 308 PLGKGKFGNVYLAREKESHYVVALKVLFKSQILDSEIEHQVRREVEIQCRL-RHPNILRM 484 P+G G FG V+ + + VA+K + + ++L Q RE+E RL P I++ Sbjct: 477 PIGTGSFGCVFAGLDLKDGREVAIKRIERLRLLP-----QFHREIENLIRLSESPRIMKY 531 Query: 485 YGYFHD 502 + D Sbjct: 532 FTCVED 537 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,603,445 Number of Sequences: 59808 Number of extensions: 286599 Number of successful extensions: 1393 Number of sequences better than 10.0: 105 Number of HSP's better than 10.0 without gapping: 1302 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 1376 length of database: 16,821,457 effective HSP length: 77 effective length of database: 12,216,241 effective search space used: 1099461690 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -