BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00208 (702 letters) Database: spombe 5004 sequences; 2,362,478 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SPMIT.10 |atp9||F0-ATPase subunit 9; similar to S. cerevisiae Q0... 35 0.013 SPCC23B6.01c |||oxysterol binding protein |Schizosaccharomyces p... 25 7.9 >SPMIT.10 |atp9||F0-ATPase subunit 9; similar to S. cerevisiae Q0130|Schizosaccharomyces pombe|chr mitochondrial|||Manual Length = 74 Score = 34.7 bits (76), Expect = 0.013 Identities = 15/22 (68%), Positives = 19/22 (86%) Frame = +1 Query: 259 ARNPSLKQQLFSYAILGFALSE 324 +RNPS++ LFS AILGFAL+E Sbjct: 36 SRNPSVRPHLFSMAILGFALTE 57 >SPCC23B6.01c |||oxysterol binding protein |Schizosaccharomyces pombe|chr 3|||Manual Length = 489 Score = 25.4 bits (53), Expect = 7.9 Identities = 12/42 (28%), Positives = 23/42 (54%) Frame = +1 Query: 397 HYYCHPTYEVSVYTIWSGQPWNRMFGNLTLIVMQGLMLLHLQ 522 ++Y P Y+V + + +P +R GN +M+G+ + LQ Sbjct: 155 YFYLCPEYKVRIDGVV--KPRSRFLGNSAASIMEGIASIKLQ 194 Database: spombe Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 2,362,478 Number of sequences in database: 5004 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 2,840,435 Number of Sequences: 5004 Number of extensions: 55766 Number of successful extensions: 139 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 134 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 139 length of database: 2,362,478 effective HSP length: 71 effective length of database: 2,007,194 effective search space used: 325165428 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -