BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00208 (702 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. 23 2.8 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 22 4.9 AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. 22 4.9 >AB270697-1|BAF75928.1| 735|Apis mellifera FoxP protein protein. Length = 735 Score = 23.0 bits (47), Expect = 2.8 Identities = 9/28 (32%), Positives = 19/28 (67%), Gaps = 1/28 (3%) Frame = -1 Query: 396 FLKVNSLESEEQQERHHK-TEQTHSLRQ 316 F++ +SL ++QQ++HH+ + H+ Q Sbjct: 91 FMQQHSLYLQQQQQQHHQDSSSEHASNQ 118 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 22.2 bits (45), Expect = 4.9 Identities = 11/28 (39%), Positives = 16/28 (57%) Frame = -1 Query: 114 ESCVGTAVTICVWVGTAASGRTSAELQK 31 +S G+ VT+ W T+ +G S LQK Sbjct: 285 DSFAGSDVTVLGWGHTSFNGMLSHILQK 312 >AB047034-1|BAB64310.1| 1598|Apis mellifera mblk-1 protein. Length = 1598 Score = 22.2 bits (45), Expect = 4.9 Identities = 10/36 (27%), Positives = 18/36 (50%) Frame = -1 Query: 375 ESEEQQERHHKTEQTHSLRQGETQNGV*EQLLLEGG 268 + ++QQ+R + ++ LR E + V E GG Sbjct: 165 QQQQQQQRQQQRQEERRLRPDEIKVEVGEDEFANGG 200 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 193,387 Number of Sequences: 438 Number of extensions: 4005 Number of successful extensions: 8 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 7 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 8 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 21561255 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -