BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00207 (591 letters) Database: arabidopsis 28,952 sequences; 12,070,560 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value At5g42970.1 68418.m05241 COP9 signalosome complex subunit 4 / CS... 45 3e-05 At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containi... 29 1.8 At4g28580.1 68417.m04088 magnesium transporter CorA-like family ... 29 3.1 At5g38090.1 68418.m04589 hypothetical protein 28 4.1 At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly id... 28 4.1 At2g29100.1 68415.m03537 glutamate receptor family protein (GLR2... 28 5.4 At1g12600.1 68414.m01463 hypothetical protein 28 5.4 At4g38180.1 68417.m05390 far-red impaired responsive protein, pu... 27 7.1 At3g02690.1 68416.m00260 integral membrane family protein simila... 27 7.1 At5g64270.1 68418.m08074 splicing factor, putative similar to sp... 27 9.4 At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16)... 27 9.4 >At5g42970.1 68418.m05241 COP9 signalosome complex subunit 4 / CSN complex subunit 4 (CSN4) (COP8) (FUS4) FUSCA4, COP8, CSN4; identical to CSN complex subunit 4 [Arabidopsis thaliana] GI:18056659, COP8 [Arabidopsis thaliana] GI:5802627; contains Pfam profile PF01399: PCI domain; identical to cDNA CSN complex subunit 4 (CSN4) GI:18056658 Length = 397 Score = 45.2 bits (102), Expect = 3e-05 Identities = 25/80 (31%), Positives = 46/80 (57%) Frame = +2 Query: 281 GLHKDQAEKYRNVLMEILKSTEQELSESLKAFIEAIVNENVSLVISRQLLTDVSTHLALL 460 G + + E+Y+ +L +L S + L ++ + FI+ I++++V LV+SRQLL + L L Sbjct: 12 GDQRQKIEQYKLILSSVLSSND--LLQAQR-FIDHILSDDVPLVVSRQLLQSFAQELGRL 68 Query: 461 ADNVSQEVSHFALDVINPEL 520 +E++ F L I P + Sbjct: 69 EPETQKEIAQFTLTQIQPRV 88 Score = 39.5 bits (88), Expect = 0.002 Identities = 16/28 (57%), Positives = 20/28 (71%) Frame = +1 Query: 508 KPRVISFEEQVASIRQHLADIYERNQNW 591 +PRV+SFEEQ IR+ LA +YE Q W Sbjct: 85 QPRVVSFEEQALVIREKLAGLYESEQEW 112 >At3g13150.1 68416.m01645 pentatricopeptide (PPR) repeat-containing protein contains Pfam profile PF01535: PPR repeat Length = 551 Score = 29.5 bits (63), Expect = 1.8 Identities = 18/51 (35%), Positives = 31/51 (60%) Frame = -1 Query: 501 SSAKCETSCETLSASSAKCVLTSVKSCLEITRLTFSLTIASMNAFNDSDNS 349 S+ K +T+ +S SSAK T V S + + SL++A+ ++ +DSD+S Sbjct: 407 SAGKKKTTSSPVS-SSAKTTSTPVSSSPDTSSFLLSLSLAADSSSSDSDSS 456 >At4g28580.1 68417.m04088 magnesium transporter CorA-like family protein (MRS2-6) weak similarity to SP|Q01926 RNA splicing protein MRS2, mitochondrial precursor {Saccharomyces cerevisiae}; contains Pfam profile PF01544: CorA-like Mg2+ transporter protein Length = 408 Score = 28.7 bits (61), Expect = 3.1 Identities = 21/71 (29%), Positives = 31/71 (43%) Frame = +2 Query: 365 LKAFIEAIVNENVSLVISRQLLTDVSTHLALLADNVSQEVSHFALDVINPELFHLKNRWP 544 L + + NEN+ + R L T + THL V E+ HF D + E +L +W Sbjct: 201 LDELTKKVSNENLKDL--RSLKTSL-THLLARVQKVRDEIEHFLDDKEDMEDLYLTRKWI 257 Query: 545 VSDST*QISTS 577 + T S S Sbjct: 258 QNQQTEAASNS 268 >At5g38090.1 68418.m04589 hypothetical protein Length = 146 Score = 28.3 bits (60), Expect = 4.1 Identities = 16/45 (35%), Positives = 24/45 (53%) Frame = +2 Query: 323 MEILKSTEQELSESLKAFIEAIVNENVSLVISRQLLTDVSTHLAL 457 M+ K E++ES A++ + N+ VI LL +ST LAL Sbjct: 53 MKFTKIPFNEVAESWIAYVMGRICNNIGFVIFLHLLYCISTRLAL 97 >At3g02260.1 68416.m00207 auxin transport protein (BIG) nearly identical to auxin transport protein; BIG [Arabidopsis thaliana] GI:21779966; contains Pfam profiles PF02207: Putative zinc finger in N-recognin, PF00569: Zinc finger ZZ type Length = 5098 Score = 28.3 bits (60), Expect = 4.1 Identities = 11/27 (40%), Positives = 17/27 (62%) Frame = -2 Query: 302 QLDLYANHPNFSTRLSLANTLQIDGHF 222 Q +L ANHPN +L N ++ DG++ Sbjct: 3303 QNELIANHPNSRIYSTLGNLVEFDGYY 3329 >At2g29100.1 68415.m03537 glutamate receptor family protein (GLR2.9) plant glutamate receptor family, PMID:11379626 Length = 940 Score = 27.9 bits (59), Expect = 5.4 Identities = 10/15 (66%), Positives = 13/15 (86%) Frame = -2 Query: 296 DLYANHPNFSTRLSL 252 D YA+HPN+ TRL+L Sbjct: 56 DFYADHPNYLTRLTL 70 >At1g12600.1 68414.m01463 hypothetical protein Length = 349 Score = 27.9 bits (59), Expect = 5.4 Identities = 11/31 (35%), Positives = 19/31 (61%) Frame = -3 Query: 310 ILFSLIFMQTTRISQLA*VWRTLCKLTGILI 218 + +LI+M R Q+ W+T KL+G+L+ Sbjct: 66 VYIALIYMYGFRTKQMVNPWKTYVKLSGVLM 96 >At4g38180.1 68417.m05390 far-red impaired responsive protein, putative similar to far-red impaired response protein FAR1 [Arabidopsis thaliana] gi|5764395|gb|AAD51282; contains Pfam:PF03101 domain: FAR1 family and PF04434: SWIM zinc finger Length = 788 Score = 27.5 bits (58), Expect = 7.1 Identities = 15/39 (38%), Positives = 23/39 (58%), Gaps = 1/39 (2%) Frame = +2 Query: 257 LSELRNSGGLHKDQAEKYRNVLMEILKSTE-QELSESLK 370 +++LRN L + E YR L+ +LK E Q+L S+K Sbjct: 738 INQLRNELELANRKCEAYRTNLLSVLKEMEDQKLQVSIK 776 >At3g02690.1 68416.m00260 integral membrane family protein similar to PecM protein (GI:5852331) {Vogesella indigofera} and PecM protein (SP:P42194) [Erwinia chrysanthemi] Length = 417 Score = 27.5 bits (58), Expect = 7.1 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -1 Query: 465 SASSAKCVLTSVKSCLEITRLT 400 S+SS+ C S SCL ITR T Sbjct: 12 SSSSSSCFFASPNSCLSITRRT 33 >At5g64270.1 68418.m08074 splicing factor, putative similar to splicing factor 3B subunit 1 (Spliceosome associated protein 155) (SAP 155) (SF3b155) (Pre-mRNA splicing factor SF3b 155 kDa subunit) (146 kDa nuclear protein) SP:O57683 from [Xenopus laevis] Length = 1269 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/55 (25%), Positives = 27/55 (49%), Gaps = 1/55 (1%) Frame = +2 Query: 290 KDQAEKYRNVLMEILKSTEQELSES-LKAFIEAIVNENVSLVISRQLLTDVSTHL 451 KD++E+YR ++ME + L S + A +E ++ + + Q D + L Sbjct: 822 KDESEQYRRMVMETIDKVVTNLGASDIDARLEELLIDGILYAFQEQTSDDANVML 876 >At4g34910.1 68417.m04950 DEAD/DEAH box helicase, putative (RH16) identical to cDNA DEAD box RNA helicase, RH16 GI:3776006 Length = 626 Score = 27.1 bits (57), Expect = 9.4 Identities = 14/60 (23%), Positives = 34/60 (56%), Gaps = 1/60 (1%) Frame = +2 Query: 323 MEILKSTEQELSESLKAFIEAIVNENVSLVISRQLLTDVSTH-LALLADNVSQEVSHFAL 499 + ++ E E E +K+F+ + N+++ ++ LLT+ + L A++V++ V+ A+ Sbjct: 437 VSLISPDEMEGFEDIKSFLASDKNKDIDIITPFPLLTENAVESLRYRAEDVAKSVTKIAV 496 Database: arabidopsis Posted date: Oct 4, 2007 10:56 AM Number of letters in database: 12,070,560 Number of sequences in database: 28,952 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 9,239,554 Number of Sequences: 28952 Number of extensions: 159817 Number of successful extensions: 477 Number of sequences better than 10.0: 11 Number of HSP's better than 10.0 without gapping: 438 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 477 length of database: 12,070,560 effective HSP length: 77 effective length of database: 9,841,256 effective search space used: 1171109464 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -