BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00206 (742 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase pro... 25 0.99 AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precurso... 23 2.3 DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. 22 7.0 AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precur... 21 9.2 AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase... 21 9.2 >AB253416-1|BAE86927.1| 580|Apis mellifera alpha-glucosidase protein. Length = 580 Score = 24.6 bits (51), Expect = 0.99 Identities = 14/50 (28%), Positives = 21/50 (42%) Frame = +1 Query: 268 KDPCNGLYRYQNRLLCNSIDLPIHNPTWLSFNGRSKNFNALLRRHRLYSY 417 +DP Y++ N S N TWL N K+ N ++ YS+ Sbjct: 419 RDPERTPYQWDNS---TSAGFSQTNKTWLPVNENYKSLNLAAQKREYYSH 465 >AJ517411-1|CAD56944.1| 1770|Apis mellifera vitellogenin precursor protein. Length = 1770 Score = 23.4 bits (48), Expect = 2.3 Identities = 10/26 (38%), Positives = 15/26 (57%) Frame = +1 Query: 508 DAYLKAIRKYDFDFSAWPVTFTADPE 585 DA+ K ++ DF FS + TAD + Sbjct: 1405 DAHFKDVKLSDFGFSTEDILDTADED 1430 >DQ071552-1|AAY82248.1| 495|Apis mellifera anarchy 1 protein. Length = 495 Score = 21.8 bits (44), Expect = 7.0 Identities = 8/33 (24%), Positives = 18/33 (54%) Frame = -1 Query: 508 LVVHGRVQSVNEFQIFRTVRSSICSHYEENSSY 410 + +HG VQS +++ + V ++ ++E Y Sbjct: 107 VTMHGTVQSYDKYDLLENVNNAARINWEYLDKY 139 >AY127579-1|AAN02286.1| 405|Apis mellifera venom protease precursor protein. Length = 405 Score = 21.4 bits (43), Expect = 9.2 Identities = 9/18 (50%), Positives = 11/18 (61%) Frame = -1 Query: 265 TNLLTPTGRYGSSCRPSK 212 T +LTP GR+ RP K Sbjct: 126 TVILTPPGRFFCEVRPIK 143 >AB204558-1|BAD89803.1| 1143|Apis mellifera nitric oxide synthase protein. Length = 1143 Score = 21.4 bits (43), Expect = 9.2 Identities = 12/39 (30%), Positives = 18/39 (46%) Frame = -3 Query: 641 SMFAHFAKGWFCSQLSCLSSGSAVKVTGQAEKSKSYFLI 525 S+ A A+ CS CL S + + G +SK L+ Sbjct: 29 SLHAGNAEKTLCSGQVCLGSVMQLPIHGTEPRSKEEILL 67 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 216,355 Number of Sequences: 438 Number of extensions: 5043 Number of successful extensions: 17 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 17 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 17 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 23144850 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -