BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00200 (753 letters) Database: mosquito 2352 sequences; 563,979 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylch... 29 0.12 AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylch... 29 0.12 AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. 23 7.7 >AY705398-1|AAU12507.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 29.5 bits (63), Expect = 0.12 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -1 Query: 564 SMLPSPDLYEPAHSHGSCLAELLRS*CNCVHVN*EH 457 S + SP +PA SH C E+ RS C CV EH Sbjct: 449 SGIKSPAFKQPAFSHSVCSTEVHRS-CFCVRFIAEH 483 >AY705397-1|AAU12506.1| 555|Anopheles gambiae nicotinic acetylcholine receptor subunitalpha 4 protein. Length = 555 Score = 29.5 bits (63), Expect = 0.12 Identities = 16/36 (44%), Positives = 19/36 (52%) Frame = -1 Query: 564 SMLPSPDLYEPAHSHGSCLAELLRS*CNCVHVN*EH 457 S + SP +PA SH C E+ RS C CV EH Sbjct: 449 SGIKSPAFKQPAFSHSVCSTEVHRS-CFCVRFIAEH 483 >AF444781-1|AAL37902.1| 1459|Anopheles gambiae Toll6 protein. Length = 1459 Score = 23.4 bits (48), Expect = 7.7 Identities = 16/50 (32%), Positives = 23/50 (46%) Frame = +2 Query: 497 NSSAKHDP*L*AGSYRSGLGSIDRLCQTTTFDCSFQTSRCCYHTYRAGEG 646 +S+A+HD GS+RS G L +TT +F H + G G Sbjct: 1365 SSAAQHDF---QGSHRSPNGCAPNLLSSTTSTTNFSYQHPHPHHHHNGSG 1411 Database: mosquito Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 563,979 Number of sequences in database: 2352 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 813,140 Number of Sequences: 2352 Number of extensions: 17379 Number of successful extensions: 37 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 32 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 37 length of database: 563,979 effective HSP length: 63 effective length of database: 415,803 effective search space used: 77755161 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -