BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00200 (753 letters) Database: human 237,096 sequences; 76,859,062 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value AK128348-1|BAC87394.1| 129|Homo sapiens protein ( Homo sapiens ... 31 3.4 U81556-1|AAB39318.1| 74|Homo sapiens hypothetical protein A4 p... 30 7.8 >AK128348-1|BAC87394.1| 129|Homo sapiens protein ( Homo sapiens cDNA FLJ46490 fis, clone THYMU3027540. ). Length = 129 Score = 31.5 bits (68), Expect = 3.4 Identities = 14/44 (31%), Positives = 21/44 (47%) Frame = +2 Query: 560 IDRLCQTTTFDCSFQTSRCCYHTYRAGEGFGFHFWRGIVQWHIC 691 I +C T C +QT C YHT+ + +H + + HIC Sbjct: 15 ITHICMYITHICVYQTHVCVYHTHM----YVYHTYMYVYHTHIC 54 >U81556-1|AAB39318.1| 74|Homo sapiens hypothetical protein A4 protein. Length = 74 Score = 30.3 bits (65), Expect = 7.8 Identities = 12/28 (42%), Positives = 18/28 (64%), Gaps = 1/28 (3%) Frame = -1 Query: 702 PSTP-QMCHCTIPLQKWNPKPSPAL*VW 622 P+TP Q CH +P + ++ KPS L +W Sbjct: 29 PATPPQQCHSHLPQRSYSAKPSQGLFLW 56 Database: human Posted date: Oct 23, 2007 1:18 PM Number of letters in database: 76,859,062 Number of sequences in database: 237,096 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 112,077,070 Number of Sequences: 237096 Number of extensions: 2507553 Number of successful extensions: 5691 Number of sequences better than 10.0: 2 Number of HSP's better than 10.0 without gapping: 5436 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 5691 length of database: 76,859,062 effective HSP length: 88 effective length of database: 55,994,614 effective search space used: 9071127468 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -