BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00199 (729 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_4535| Best HMM Match : F5_F8_type_C (HMM E-Value=3.92364e-44) 49 4e-06 SB_23989| Best HMM Match : Yippee (HMM E-Value=2.8e-09) 43 2e-04 SB_26778| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.31 >SB_4535| Best HMM Match : F5_F8_type_C (HMM E-Value=3.92364e-44) Length = 972 Score = 48.8 bits (111), Expect = 4e-06 Identities = 21/42 (50%), Positives = 29/42 (69%) Frame = +1 Query: 253 FCKNCGTKLGWVYEFATEENQRYKEGRVILERALVTESDGIE 378 FC+ C T LGW YE A E +Q+YKEG+ I+E A + + +G E Sbjct: 931 FCECCKTTLGWKYEHAFEISQKYKEGKYIIEMAHMIKDNGWE 972 >SB_23989| Best HMM Match : Yippee (HMM E-Value=2.8e-09) Length = 93 Score = 43.2 bits (97), Expect = 2e-04 Identities = 17/35 (48%), Positives = 23/35 (65%) Frame = +1 Query: 253 FCKNCGTKLGWVYEFATEENQRYKEGRVILERALV 357 +C C T +GW Y A EE ++YK G+ ILERA + Sbjct: 25 YCNKCATYVGWKYIDAYEEKEKYKVGKFILERAKI 59 >SB_26778| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1050 Score = 32.7 bits (71), Expect = 0.31 Identities = 18/45 (40%), Positives = 25/45 (55%), Gaps = 3/45 (6%) Frame = +1 Query: 121 CDVNL-TNRSELISTRFTGATGCESNLFGS--SGSCDANRTSHGA 246 CDVN +N S + TGA C SN +G+ C++N +SH A Sbjct: 707 CDVNCNSNSSHFTCNKTTGARVCHSNWYGTYCDVYCNSNSSSHFA 751 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,931,187 Number of Sequences: 59808 Number of extensions: 318468 Number of successful extensions: 688 Number of sequences better than 10.0: 3 Number of HSP's better than 10.0 without gapping: 618 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 684 length of database: 16,821,457 effective HSP length: 80 effective length of database: 12,036,817 effective search space used: 1949964354 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -