BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00197 (638 letters) Database: nematostella 59,808 sequences; 16,821,457 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) 44 8e-05 SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.085 SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) 34 0.085 SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) 33 0.15 SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) 33 0.26 SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) 32 0.45 SB_18764| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.60 SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.60 SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.60 SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.60 SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 0.79 SB_29636| Best HMM Match : No HMM Matches (HMM E-Value=.) 31 1.0 SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_23611| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.4 SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) 30 1.8 SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) 29 2.4 SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 2.4 SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) 29 3.2 SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_51848| Best HMM Match : DUF1135 (HMM E-Value=6.4e-09) 29 3.2 SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 3.2 SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) 29 3.2 SB_1685| Best HMM Match : DUF754 (HMM E-Value=2.7) 29 3.2 SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) 29 4.2 SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_53810| Best HMM Match : DUF1542 (HMM E-Value=3.9) 29 4.2 SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_47763| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) 29 4.2 SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) 28 5.6 SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) 28 5.6 SB_46128| Best HMM Match : VQ (HMM E-Value=4.6) 28 5.6 SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) 28 5.6 SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) 28 5.6 SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) 28 5.6 SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_1740| Best HMM Match : Protamine_P2 (HMM E-Value=0.9) 28 5.6 SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) 28 5.6 SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) 28 5.6 SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) 28 5.6 SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_5716| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 5.6 SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_38305| Best HMM Match : CW_binding_1 (HMM E-Value=0.4) 28 7.4 SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_27055| Best HMM Match : PWI (HMM E-Value=3.5e-08) 28 7.4 SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) 28 7.4 SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) 28 7.4 SB_56887| Best HMM Match : TolA (HMM E-Value=0.66) 28 7.4 SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_49798| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_46001| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_37674| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) 28 7.4 SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) 28 7.4 SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) 28 7.4 SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) 27 9.7 SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) 27 9.7 SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_36751| Best HMM Match : Exo_endo_phos (HMM E-Value=2e-12) 27 9.7 SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) 27 9.7 SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) 27 9.7 SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) 27 9.7 SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_48720| Best HMM Match : DAGAT (HMM E-Value=1.5e-09) 27 9.7 SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) 27 9.7 SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_43512| Best HMM Match : RNA_pol_delta (HMM E-Value=4.7) 27 9.7 SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) 27 9.7 SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_29496| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12) 27 9.7 SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) 27 9.7 SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_876| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_516| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 SB_454| Best HMM Match : No HMM Matches (HMM E-Value=.) 27 9.7 >SB_57694| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 272 Score = 44.4 bits (100), Expect = 8e-05 Identities = 32/76 (42%), Positives = 41/76 (53%), Gaps = 3/76 (3%) Frame = +1 Query: 13 IVDPPGCRNSARASSL-EDYRIKDEPDPDVRISQDDADKMVEPKNEFYEDEKD-NDKELP 186 +VDPPGCRNS + ED +DE D +D D+ E N+ +D KD ND++ Sbjct: 15 LVDPPGCRNSMDPNDQDEDTGDQDEDTGDQVQDPNDQDQDPEDPNDQDQDPKDPNDQDQD 74 Query: 187 PEIKDP-*QIELPPDP 231 P KDP Q E P DP Sbjct: 75 P--KDPNDQDEDPKDP 88 >SB_24159| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 34.3 bits (75), Expect = 0.085 Identities = 14/20 (70%), Positives = 15/20 (75%) Frame = -2 Query: 61 PGKKLVPNSCSPGDPLFXTR 2 PG+ LV NSCSPGDPL R Sbjct: 13 PGRLLVSNSCSPGDPLVLER 32 >SB_20081| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 173 Score = 34.3 bits (75), Expect = 0.085 Identities = 14/21 (66%), Positives = 15/21 (71%) Frame = -2 Query: 64 LPGKKLVPNSCSPGDPLFXTR 2 LPG+K NSCSPGDPL R Sbjct: 43 LPGEKKTSNSCSPGDPLVLER 63 >SB_58683| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 33.5 bits (73), Expect = 0.15 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -2 Query: 61 PGKKLVPNSCSPGDPLFXTR 2 PGK L NSCSPGDPL R Sbjct: 23 PGKHLPSNSCSPGDPLVLER 42 >SB_25723| Best HMM Match : Vicilin_N (HMM E-Value=0.0045) Length = 2506 Score = 32.7 bits (71), Expect = 0.26 Identities = 20/63 (31%), Positives = 34/63 (53%) Frame = +1 Query: 13 IVDPPGCRNSARASSLEDYRIKDEPDPDVRISQDDADKMVEPKNEFYEDEKDNDKELPPE 192 +VDPPGCRNS SS +IK++ P+++ + ++ N F E+D K++ Sbjct: 659 LVDPPGCRNS--ISSSNQRKIKEKKAPNLQEVRSLVGSII--ANAFDAIEEDQRKQVKCM 714 Query: 193 IKD 201 + D Sbjct: 715 VGD 717 >SB_26655| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 48 Score = 31.9 bits (69), Expect = 0.45 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = +1 Query: 13 IVDPPGCRNSARASSLEDY 69 +VDPPGCRNS + L DY Sbjct: 15 LVDPPGCRNSILLTELADY 33 >SB_51469| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 31.9 bits (69), Expect = 0.45 Identities = 14/23 (60%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -2 Query: 67 NLPGKKLVP-NSCSPGDPLFXTR 2 N+PG + P NSCSPGDPL R Sbjct: 6 NIPGSRHEPSNSCSPGDPLVLER 28 >SB_18764| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 284 Score = 31.5 bits (68), Expect = 0.60 Identities = 13/35 (37%), Positives = 21/35 (60%) Frame = +1 Query: 79 DEPDPDVRISQDDADKMVEPKNEFYEDEKDNDKEL 183 DE +P + IS DD D + +E+ ED+ D + E+ Sbjct: 120 DEDEPQIIISSDDEDPGADGGDEYDEDDIDTESEV 154 >SB_46709| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 176 Score = 31.5 bits (68), Expect = 0.60 Identities = 11/19 (57%), Positives = 16/19 (84%) Frame = +1 Query: 13 IVDPPGCRNSARASSLEDY 69 +VDPPGCRNS +A S++ + Sbjct: 15 LVDPPGCRNSIQARSVDGF 33 >SB_36256| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 122 Score = 31.5 bits (68), Expect = 0.60 Identities = 15/29 (51%), Positives = 17/29 (58%) Frame = +1 Query: 13 IVDPPGCRNSARASSLEDYRIKDEPDPDV 99 +VDPPGCRNS AS L + D DV Sbjct: 15 LVDPPGCRNSMVASELMEIYSMYNNDKDV 43 >SB_24786| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 31.5 bits (68), Expect = 0.60 Identities = 13/20 (65%), Positives = 14/20 (70%) Frame = -2 Query: 61 PGKKLVPNSCSPGDPLFXTR 2 P +LV NSCSPGDPL R Sbjct: 22 PRARLVSNSCSPGDPLVLER 41 >SB_41112| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 31.1 bits (67), Expect = 0.79 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 67 NLPGKKLVPNSCSPGDPLFXTR 2 N+ G+ NSCSPGDPL R Sbjct: 12 NIKGRHCASNSCSPGDPLVLER 33 >SB_29636| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 306 Score = 30.7 bits (66), Expect = 1.0 Identities = 14/42 (33%), Positives = 24/42 (57%) Frame = +1 Query: 76 KDEPDPDVRISQDDADKMVEPKNEFYEDEKDNDKELPPEIKD 201 ++ P + ++DA K PK E E+ K++ KE P +I+D Sbjct: 256 EESPKEEDTPKEEDAPKEDTPKEEAKEEPKEDTKEEPKKIED 297 >SB_52630| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 61 PGKKLVPNSCSPGDPLFXTR 2 P K L NSCSPGDPL R Sbjct: 16 PPKNLRSNSCSPGDPLVLER 35 >SB_30432| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 346 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 K+++ NSCSPGDPL R Sbjct: 117 KEIISNSCSPGDPLVLER 134 >SB_23611| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 30.3 bits (65), Expect = 1.4 Identities = 16/43 (37%), Positives = 23/43 (53%) Frame = +1 Query: 52 SSLEDYRIKDEPDPDVRISQDDADKMVEPKNEFYEDEKDNDKE 180 S +D + DE D+ +DD D+ E +E +EDE D D E Sbjct: 2 SDSDDALLSDEEGEDIT-REDDDDEEEEDDDEDFEDEDDYDDE 43 >SB_19659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 30.3 bits (65), Expect = 1.4 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -2 Query: 67 NLPGKKLVP--NSCSPGDPLFXTR 2 N+P + L P NSCSPGDPL R Sbjct: 12 NIPHELLAPTSNSCSPGDPLVLER 35 >SB_44783| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = -2 Query: 61 PGKKLVPNSCSPGDPLFXTR 2 PGK NSCSPGDPL R Sbjct: 2 PGKLEPSNSCSPGDPLVLER 21 >SB_40102| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 58 GKKLVPNSCSPGDPLFXTR 2 G K V NSCSPGDPL R Sbjct: 27 GNKDVSNSCSPGDPLVLER 45 >SB_31357| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 K L+ NSCSPGDPL R Sbjct: 38 KHLISNSCSPGDPLVLER 55 >SB_25053| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 58 GKKLVPNSCSPGDPLFXTR 2 GK V NSCSPGDPL R Sbjct: 28 GKIAVSNSCSPGDPLVLER 46 >SB_17859| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 30.3 bits (65), Expect = 1.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = -2 Query: 64 LPGKKLVPNSCSPGDPLFXTR 2 +P ++ NSCSPGDPL R Sbjct: 32 IPSTQMASNSCSPGDPLVLER 52 >SB_14956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/19 (63%), Positives = 14/19 (73%) Frame = -2 Query: 58 GKKLVPNSCSPGDPLFXTR 2 G+ +V NSCSPGDPL R Sbjct: 3 GEGIVSNSCSPGDPLVLER 21 >SB_12588| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 338 Score = 30.3 bits (65), Expect = 1.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 58 GKKLVPNSCSPGDPLFXTR 2 GK L NSCSPGDPL R Sbjct: 210 GKHLRSNSCSPGDPLVLER 228 >SB_9210| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 30.3 bits (65), Expect = 1.4 Identities = 12/18 (66%), Positives = 14/18 (77%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 +K+V NSCSPGDPL R Sbjct: 25 QKVVSNSCSPGDPLVLER 42 >SB_48718| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 KK+ NSCSPGDPL R Sbjct: 17 KKIPSNSCSPGDPLVLER 34 >SB_23161| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 124 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/23 (52%), Positives = 15/23 (65%) Frame = -2 Query: 70 GNLPGKKLVPNSCSPGDPLFXTR 2 G++ K+ NSCSPGDPL R Sbjct: 2 GSVMFKRFASNSCSPGDPLVLER 24 >SB_7969| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 157 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 61 PGKKLVPNSCSPGDPLFXTR 2 P K + NSCSPGDPL R Sbjct: 28 PENKALSNSCSPGDPLVLER 47 >SB_5754| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 29.9 bits (64), Expect = 1.8 Identities = 12/19 (63%), Positives = 13/19 (68%) Frame = -2 Query: 58 GKKLVPNSCSPGDPLFXTR 2 G K + NSCSPGDPL R Sbjct: 26 GAKEISNSCSPGDPLVLER 44 >SB_55776| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 205 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/24 (50%), Positives = 13/24 (54%) Frame = -2 Query: 73 FGNLPGKKLVPNSCSPGDPLFXTR 2 F P + NSCSPGDPL R Sbjct: 72 FSQSPLSRFTSNSCSPGDPLVLER 95 >SB_35514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 29.5 bits (63), Expect = 2.4 Identities = 16/30 (53%), Positives = 17/30 (56%), Gaps = 3/30 (10%) Frame = +1 Query: 13 IVDPPGCRNS---ARASSLEDYRIKDEPDP 93 +VDPPGCRNS AR SS PDP Sbjct: 15 LVDPPGCRNSMENARTSSPGFQGAYSAPDP 44 >SB_54313| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 KK + NSCSPGDPL R Sbjct: 9 KKSLSNSCSPGDPLVLER 26 >SB_54105| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 29.5 bits (63), Expect = 2.4 Identities = 14/22 (63%), Positives = 15/22 (68%), Gaps = 1/22 (4%) Frame = -2 Query: 64 LPGK-KLVPNSCSPGDPLFXTR 2 LPG + V NSCSPGDPL R Sbjct: 57 LPGNLRPVSNSCSPGDPLVLER 78 >SB_38326| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 104 Score = 29.5 bits (63), Expect = 2.4 Identities = 10/15 (66%), Positives = 14/15 (93%) Frame = +1 Query: 13 IVDPPGCRNSARASS 57 +VDPPGCRNS R+++ Sbjct: 15 LVDPPGCRNSIRSTT 29 >SB_27816| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 214 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 Query: 67 NLPGKKLVPNSCSPGDPLFXTR 2 N+P NSCSPGDPL R Sbjct: 84 NIPPSVSTSNSCSPGDPLVLER 105 >SB_23012| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 210 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/18 (61%), Positives = 14/18 (77%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 +++V NSCSPGDPL R Sbjct: 83 QRIVSNSCSPGDPLVLER 100 >SB_12453| Best HMM Match : DUF765 (HMM E-Value=5) Length = 140 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 K L NSCSPGDPL R Sbjct: 13 KSLTSNSCSPGDPLVLER 30 >SB_5856| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.5 bits (63), Expect = 2.4 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 58 GKKLVPNSCSPGDPLFXTR 2 G ++ NSCSPGDPL R Sbjct: 23 GSLIISNSCSPGDPLVLER 41 >SB_2747| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 29.5 bits (63), Expect = 2.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 KK NSCSPGDPL R Sbjct: 35 KKCTSNSCSPGDPLVLER 52 >SB_59238| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 LV NSCSPGDPL R Sbjct: 24 LVSNSCSPGDPLVLER 39 >SB_42175| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/20 (60%), Positives = 13/20 (65%) Frame = -2 Query: 61 PGKKLVPNSCSPGDPLFXTR 2 P K + NSCSPGDPL R Sbjct: 57 PTAKKLSNSCSPGDPLVLER 76 >SB_41956| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 LV NSCSPGDPL R Sbjct: 3 LVSNSCSPGDPLVLER 18 >SB_26393| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 3.2 Identities = 14/24 (58%), Positives = 16/24 (66%), Gaps = 2/24 (8%) Frame = -2 Query: 67 NLPGKKLV--PNSCSPGDPLFXTR 2 N+P KL+ NSCSPGDPL R Sbjct: 12 NIPKLKLLITSNSCSPGDPLVLER 35 >SB_21366| Best HMM Match : YL1 (HMM E-Value=6.4) Length = 365 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 KK NSCSPGDPL R Sbjct: 238 KKKTSNSCSPGDPLVLER 255 >SB_56967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 LV NSCSPGDPL R Sbjct: 9 LVSNSCSPGDPLVLER 24 >SB_51848| Best HMM Match : DUF1135 (HMM E-Value=6.4e-09) Length = 498 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/31 (48%), Positives = 18/31 (58%), Gaps = 1/31 (3%) Frame = +2 Query: 62 KITESRTNPILTFVSV-RTMLTKWWSPKTSF 151 K E P+L FVSV RT+ W+ PK SF Sbjct: 410 KFQEIPLTPMLVFVSVPRTVKNYWFRPKPSF 440 >SB_43731| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 LV NSCSPGDPL R Sbjct: 5 LVSNSCSPGDPLVLER 20 >SB_41197| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 LV NSCSPGDPL R Sbjct: 2 LVSNSCSPGDPLVLER 17 >SB_30574| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 399 Score = 29.1 bits (62), Expect = 3.2 Identities = 15/33 (45%), Positives = 16/33 (48%) Frame = -2 Query: 100 ERQDRVRP*FGNLPGKKLVPNSCSPGDPLFXTR 2 ER+ VR L NSCSPGDPL R Sbjct: 3 ERRQSVRAQSNVREAAPLASNSCSPGDPLVLER 35 >SB_22418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 145 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 Query: 67 NLPGKKLVPNSCSPGDPLFXTR 2 N K + NSCSPGDPL R Sbjct: 14 NTQSKLVASNSCSPGDPLVLER 35 >SB_17901| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 29.1 bits (62), Expect = 3.2 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 LV NSCSPGDPL R Sbjct: 26 LVSNSCSPGDPLVLER 41 >SB_9975| Best HMM Match : 7tm_2 (HMM E-Value=1.9e-38) Length = 1101 Score = 29.1 bits (62), Expect = 3.2 Identities = 13/24 (54%), Positives = 14/24 (58%) Frame = -2 Query: 73 FGNLPGKKLVPNSCSPGDPLFXTR 2 F L +L NSCSPGDPL R Sbjct: 653 FAILNSLQLASNSCSPGDPLVLER 676 >SB_1685| Best HMM Match : DUF754 (HMM E-Value=2.7) Length = 131 Score = 29.1 bits (62), Expect = 3.2 Identities = 16/49 (32%), Positives = 24/49 (48%) Frame = +1 Query: 28 GCRNSARASSLEDYRIKDEPDPDVRISQDDADKMVEPKNEFYEDEKDND 174 G RN R D ++ E D D + + DD DK +Y++E D+D Sbjct: 75 GQRNLLRQPDSAD-ALEQEDDNDDKENDDDYDKEEVDYENYYDEEDDDD 122 >SB_56430| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 33 LISNSCSPGDPLVLER 48 >SB_50135| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 17 LISNSCSPGDPLVLER 32 >SB_49285| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/17 (58%), Positives = 13/17 (76%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 +++ NSCSPGDPL R Sbjct: 16 RIISNSCSPGDPLVLER 32 >SB_41011| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 KK NSCSPGDPL R Sbjct: 39 KKNASNSCSPGDPLVLER 56 >SB_31351| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 137 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 K++ NSCSPGDPL R Sbjct: 11 KVLSNSCSPGDPLVLER 27 >SB_25921| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 37 LISNSCSPGDPLVLER 52 >SB_16794| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1407 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/18 (66%), Positives = 13/18 (72%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 +K V NSCSPGDPL R Sbjct: 1063 EKEVSNSCSPGDPLVLER 1080 >SB_13100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 175 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/37 (40%), Positives = 19/37 (51%) Frame = -2 Query: 112 PD*YERQDRVRP*FGNLPGKKLVPNSCSPGDPLFXTR 2 PD D+ P G + + + NSCSPGDPL R Sbjct: 29 PDTTVITDKPPPKKGPVQDEIKISNSCSPGDPLVLER 65 >SB_12434| Best HMM Match : SAB (HMM E-Value=4.6) Length = 160 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/16 (75%), Positives = 12/16 (75%) Frame = -1 Query: 59 REEARAEFLQPGGSTI 12 R R EFLQPGGSTI Sbjct: 32 RHHGRIEFLQPGGSTI 47 >SB_8860| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 KK NSCSPGDPL R Sbjct: 29 KKNASNSCSPGDPLVLER 46 >SB_8543| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 K+ NSCSPGDPL R Sbjct: 17 KITSNSCSPGDPLVLER 33 >SB_7024| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 KL NSCSPGDPL R Sbjct: 33 KLSSNSCSPGDPLVLER 49 >SB_1988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 3889 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/17 (64%), Positives = 13/17 (76%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 ++V NSCSPGDPL R Sbjct: 3473 RVVSNSCSPGDPLVLER 3489 >SB_58927| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 8 LISNSCSPGDPLVLER 23 >SB_54757| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 33 LISNSCSPGDPLVLER 48 >SB_54339| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 153 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 K+ NSCSPGDPL R Sbjct: 27 KIASNSCSPGDPLVLER 43 >SB_53810| Best HMM Match : DUF1542 (HMM E-Value=3.9) Length = 560 Score = 28.7 bits (61), Expect = 4.2 Identities = 15/45 (33%), Positives = 21/45 (46%) Frame = +1 Query: 37 NSARASSLEDYRIKDEPDPDVRISQDDADKMVEPKNEFYEDEKDN 171 N A +DY D D D+ I DDAD ++ Y D+ D+ Sbjct: 283 NDAADDDADDYVNSDADDEDINIGDDDAD-----DDDIYGDDDDD 322 >SB_50032| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 33 LISNSCSPGDPLVLER 48 >SB_47763| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 88 Score = 28.7 bits (61), Expect = 4.2 Identities = 14/39 (35%), Positives = 22/39 (56%) Frame = +1 Query: 64 DYRIKDEPDPDVRISQDDADKMVEPKNEFYEDEKDNDKE 180 DY +K EP D+ DD D+ E + E E+E++ +E Sbjct: 34 DYSVKQEP-CDLMTDDDDDDEEEEEEEEEEEEEEEEKEE 71 >SB_47635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 33 LISNSCSPGDPLVLER 48 >SB_46641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 191 Score = 28.7 bits (61), Expect = 4.2 Identities = 12/17 (70%), Positives = 12/17 (70%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 KL NSCSPGDPL R Sbjct: 65 KLSSNSCSPGDPLVLER 81 >SB_46370| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 204 Score = 28.7 bits (61), Expect = 4.2 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 13 IVDPPGCRNSARASSLED 66 +VDPPGCRNS + + D Sbjct: 32 LVDPPGCRNSIDGNGVSD 49 >SB_45427| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 24 LISNSCSPGDPLVLER 39 >SB_43613| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 33 LISNSCSPGDPLVLER 48 >SB_43412| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 33 LISNSCSPGDPLVLER 48 >SB_31108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 33 LISNSCSPGDPLVLER 48 >SB_30656| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 K+ NSCSPGDPL R Sbjct: 2 KITSNSCSPGDPLVLER 18 >SB_26762| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 70 LISNSCSPGDPLVLER 85 >SB_21994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 34 LISNSCSPGDPLVLER 49 >SB_17082| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 146 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 21 LISNSCSPGDPLVLER 36 >SB_15848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 187 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 58 GKKLVPNSCSPGDPLFXTR 2 G + NSCSPGDPL R Sbjct: 59 GSNFLSNSCSPGDPLVLER 77 >SB_12793| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 16 LISNSCSPGDPLVLER 31 >SB_11993| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 58 GKKLVPNSCSPGDPLFXTR 2 G++ NSCSPGDPL R Sbjct: 24 GRRAKSNSCSPGDPLVLER 42 >SB_8174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 33 LISNSCSPGDPLVLER 48 >SB_4560| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 28.7 bits (61), Expect = 4.2 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 31 LISNSCSPGDPLVLER 46 >SB_58695| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 28.3 bits (60), Expect = 5.6 Identities = 14/22 (63%), Positives = 14/22 (63%), Gaps = 3/22 (13%) Frame = -2 Query: 58 GKKLVP---NSCSPGDPLFXTR 2 G LVP NSCSPGDPL R Sbjct: 19 GASLVPRPSNSCSPGDPLVLER 40 >SB_57745| Best HMM Match : Extensin_2 (HMM E-Value=0.69) Length = 472 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 +V NSCSPGDPL R Sbjct: 347 IVSNSCSPGDPLVLER 362 >SB_56428| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -1 Query: 59 REEARAEFLQPGGST 15 REE EFLQPGGST Sbjct: 19 REERMIEFLQPGGST 33 >SB_51095| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 177 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/19 (57%), Positives = 13/19 (68%) Frame = -2 Query: 58 GKKLVPNSCSPGDPLFXTR 2 G ++ NSCSPGDPL R Sbjct: 49 GFRVASNSCSPGDPLVLER 67 >SB_50722| Best HMM Match : Cullin (HMM E-Value=1.2e-20) Length = 385 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/20 (55%), Positives = 13/20 (65%) Frame = -2 Query: 61 PGKKLVPNSCSPGDPLFXTR 2 P + + NSCSPGDPL R Sbjct: 256 PVTEYISNSCSPGDPLVLER 275 >SB_46128| Best HMM Match : VQ (HMM E-Value=4.6) Length = 333 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/30 (36%), Positives = 19/30 (63%) Frame = -3 Query: 423 SVTVKKPYPLQSKKHWHYNVFFLHLTDLTQ 334 SVT+++PY + ++ ++ FF H T TQ Sbjct: 67 SVTLQQPYSVLPSRYNNHTAFFRHATTTTQ 96 >SB_41066| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 + L+ NSCSPGDPL R Sbjct: 60 RTLLSNSCSPGDPLVLER 77 >SB_40550| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -2 Query: 58 GKKLVPNSCSPGDPLFXTR 2 G + NSCSPGDPL R Sbjct: 16 GSQTASNSCSPGDPLVLER 34 >SB_21764| Best HMM Match : TPP_enzyme_N (HMM E-Value=1.1e-06) Length = 183 Score = 28.3 bits (60), Expect = 5.6 Identities = 10/12 (83%), Positives = 11/12 (91%) Frame = +1 Query: 13 IVDPPGCRNSAR 48 +VDPPGCRNS R Sbjct: 15 LVDPPGCRNSIR 26 >SB_18012| Best HMM Match : Flavoprotein (HMM E-Value=4.4) Length = 180 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/20 (55%), Positives = 14/20 (70%) Frame = -2 Query: 61 PGKKLVPNSCSPGDPLFXTR 2 P + ++ NSCSPGDPL R Sbjct: 51 PLEPILSNSCSPGDPLVLER 70 >SB_12571| Best HMM Match : SBF (HMM E-Value=1.6e-37) Length = 257 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = +1 Query: 13 IVDPPGCRNSARASSL 60 +VDPPGCRNS S L Sbjct: 32 LVDPPGCRNSIMDSGL 47 >SB_6886| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 202 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 +V NSCSPGDPL R Sbjct: 77 IVSNSCSPGDPLVLER 92 >SB_4994| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 113 Score = 28.3 bits (60), Expect = 5.6 Identities = 10/18 (55%), Positives = 14/18 (77%) Frame = +1 Query: 13 IVDPPGCRNSARASSLED 66 +VDPPGCRNS A + ++ Sbjct: 15 LVDPPGCRNSIAADANQE 32 >SB_1740| Best HMM Match : Protamine_P2 (HMM E-Value=0.9) Length = 268 Score = 28.3 bits (60), Expect = 5.6 Identities = 17/57 (29%), Positives = 31/57 (54%) Frame = +1 Query: 28 GCRNSARASSLEDYRIKDEPDPDVRISQDDADKMVEPKNEFYEDEKDNDKELPPEIK 198 G A E Y + D PD + + +D++D+ + K + ++EK+N+ EL P+ K Sbjct: 82 GALEKAGKEDKEVYDL-DLPDDENEMDRDESDESEDEKMKAGKEEKENE-ELNPQRK 136 >SB_45536| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 79 P*FGNLPGKKLVPNSCSPGDPLFXTR 2 P F + V NSCSPGDPL R Sbjct: 4 PKFPGAVNRDEVSNSCSPGDPLVLER 29 >SB_45525| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 +V NSCSPGDPL R Sbjct: 11 MVSNSCSPGDPLVLER 26 >SB_41071| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 +V NSCSPGDPL R Sbjct: 1 MVSNSCSPGDPLVLER 16 >SB_40073| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 171 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 K + NSCSPGDPL R Sbjct: 44 KDIASNSCSPGDPLVLER 61 >SB_37676| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = -2 Query: 64 LPGKKLVPNSCSPGDPLFXTR 2 L ++++ NSCSPGDPL R Sbjct: 8 LEKRQVLSNSCSPGDPLVLER 28 >SB_36738| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 KK NSCSPGDPL R Sbjct: 3 KKRSSNSCSPGDPLVLER 20 >SB_34444| Best HMM Match : Cadherin (HMM E-Value=0.0043) Length = 205 Score = 28.3 bits (60), Expect = 5.6 Identities = 10/14 (71%), Positives = 12/14 (85%) Frame = +1 Query: 13 IVDPPGCRNSARAS 54 +VDPPGCRNS A+ Sbjct: 15 LVDPPGCRNSMNAN 28 >SB_33166| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 28.3 bits (60), Expect = 5.6 Identities = 15/29 (51%), Positives = 16/29 (55%) Frame = -2 Query: 88 RVRP*FGNLPGKKLVPNSCSPGDPLFXTR 2 R P G LP + NSCSPGDPL R Sbjct: 48 RCTPVVGMLPRRS---NSCSPGDPLVLER 73 >SB_31592| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 251 Score = 28.3 bits (60), Expect = 5.6 Identities = 13/26 (50%), Positives = 13/26 (50%) Frame = -2 Query: 79 P*FGNLPGKKLVPNSCSPGDPLFXTR 2 P L G NSCSPGDPL R Sbjct: 5 PQLPTLAGSPFRSNSCSPGDPLVLER 30 >SB_29978| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/18 (61%), Positives = 13/18 (72%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 ++L NSCSPGDPL R Sbjct: 9 QELTSNSCSPGDPLVLER 26 >SB_19004| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 +V NSCSPGDPL R Sbjct: 13 IVSNSCSPGDPLVLER 28 >SB_18836| Best HMM Match : C1_1 (HMM E-Value=7.3e-17) Length = 1440 Score = 28.3 bits (60), Expect = 5.6 Identities = 22/64 (34%), Positives = 31/64 (48%), Gaps = 2/64 (3%) Frame = +1 Query: 19 DPPGCRNSARASSLEDYRIKDEP--DPDVRISQDDADKMVEPKNEFYEDEKDNDKELPPE 192 D P SS RI +EP +P+V Q++AD E + E E E ++D+ LPP Sbjct: 1069 DAPPAPQDESTSSRAVPRI-EEPVNEPEVEDPQEEADTETETEPETAE-EVESDEPLPPP 1126 Query: 193 IKDP 204 P Sbjct: 1127 PPPP 1130 >SB_12358| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 +V NSCSPGDPL R Sbjct: 1 MVSNSCSPGDPLVLER 16 >SB_9854| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 61 PGKKLVPNSCSPGDPLFXTR 2 PG NSCSPGDPL R Sbjct: 14 PGYGPASNSCSPGDPLVLER 33 >SB_9638| Best HMM Match : WD40 (HMM E-Value=8.4e-09) Length = 781 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 67 NLPGKKLVPNSCSPGDPLFXTR 2 ++P NSCSPGDPL R Sbjct: 508 SVPSSSTPSNSCSPGDPLVLER 529 >SB_8232| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 192 Score = 28.3 bits (60), Expect = 5.6 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 67 NLPGKKLVPNSCSPGDPLFXTR 2 N+ K + NSCSPGDPL R Sbjct: 61 NIIQKIKISNSCSPGDPLVLER 82 >SB_5716| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 108 Score = 28.3 bits (60), Expect = 5.6 Identities = 18/61 (29%), Positives = 31/61 (50%), Gaps = 2/61 (3%) Frame = +1 Query: 1 AWXRIVDPPGCRNSARASSLEDYRIK--DEPDPDVRISQDDADKMVEPKNEFYEDEKDND 174 AW +V+ S +D++ K DEP+P ++ DD D + ++ +D+ DND Sbjct: 47 AWTCLVNQHTWLTKLLTSCRDDHQRKGKDEPNP-LQTFNDDDDDNDDAADDDDDDDDDND 105 Query: 175 K 177 K Sbjct: 106 K 106 >SB_4523| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 169 Score = 28.3 bits (60), Expect = 5.6 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 K + NSCSPGDPL R Sbjct: 42 KPTISNSCSPGDPLVLER 59 >SB_54935| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 201 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/21 (52%), Positives = 14/21 (66%) Frame = +1 Query: 13 IVDPPGCRNSARASSLEDYRI 75 +VDPPGCRNS S ++ I Sbjct: 15 LVDPPGCRNSMIGSGGREHAI 35 >SB_40614| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/20 (55%), Positives = 12/20 (60%) Frame = -2 Query: 61 PGKKLVPNSCSPGDPLFXTR 2 P + NSCSPGDPL R Sbjct: 33 PYDNIASNSCSPGDPLVLER 52 >SB_39247| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/23 (52%), Positives = 13/23 (56%) Frame = -2 Query: 70 GNLPGKKLVPNSCSPGDPLFXTR 2 G+ L NSCSPGDPL R Sbjct: 16 GHAKNDALSSNSCSPGDPLVLER 38 >SB_38305| Best HMM Match : CW_binding_1 (HMM E-Value=0.4) Length = 1145 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/62 (25%), Positives = 28/62 (45%) Frame = +1 Query: 19 DPPGCRNSARASSLEDYRIKDEPDPDVRISQDDADKMVEPKNEFYEDEKDNDKELPPEIK 198 D GC + +DY D+ D D DD D+ + +++ +D+ D+D + Sbjct: 56 DDEGCDDDDDDYDDDDYDDDDDDDDDKGCDDDD-DEGCDDDDDYDDDDDDDDDGDDADPT 114 Query: 199 DP 204 DP Sbjct: 115 DP 116 >SB_27874| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 166 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 67 NLPGKKLVPNSCSPGDPLFXTR 2 +L K+ NSCSPGDPL R Sbjct: 35 HLSHKRSSSNSCSPGDPLVLER 56 >SB_27055| Best HMM Match : PWI (HMM E-Value=3.5e-08) Length = 677 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/37 (32%), Positives = 20/37 (54%) Frame = +1 Query: 94 DVRISQDDADKMVEPKNEFYEDEKDNDKELPPEIKDP 204 D + A+ V+ K ++ KD+D+ LPP I +P Sbjct: 99 DDNADEKPAESKVKRKQSRFDALKDDDEPLPPAIPEP 135 >SB_21861| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/22 (54%), Positives = 16/22 (72%), Gaps = 1/22 (4%) Frame = -2 Query: 64 LPGKKL-VPNSCSPGDPLFXTR 2 + G++L + NSCSPGDPL R Sbjct: 1 MAGRRLFLSNSCSPGDPLVLER 22 >SB_19108| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 7.4 Identities = 16/33 (48%), Positives = 18/33 (54%), Gaps = 4/33 (12%) Frame = -2 Query: 88 RVRP*FGNLPGKKLVP----NSCSPGDPLFXTR 2 R+RP F P K + NSCSPGDPL R Sbjct: 24 RLRPHFEGDPVKVSISFFLSNSCSPGDPLVLER 56 >SB_16326| Best HMM Match : Sushi (HMM E-Value=5.4e-18) Length = 258 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/22 (54%), Positives = 14/22 (63%) Frame = -2 Query: 67 NLPGKKLVPNSCSPGDPLFXTR 2 NL + + NSCSPGDPL R Sbjct: 127 NLRARIVGSNSCSPGDPLVLER 148 >SB_12111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 447 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/19 (63%), Positives = 12/19 (63%) Frame = -2 Query: 58 GKKLVPNSCSPGDPLFXTR 2 G L NSCSPGDPL R Sbjct: 75 GILLTSNSCSPGDPLVLER 93 >SB_9512| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/25 (48%), Positives = 16/25 (64%) Frame = +1 Query: 13 IVDPPGCRNSARASSLEDYRIKDEP 87 +VDPPGCRNS + +KD+P Sbjct: 15 LVDPPGCRNSIKVHK----DVKDKP 35 >SB_3970| Best HMM Match : Drf_FH1 (HMM E-Value=1.2) Length = 558 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/23 (47%), Positives = 13/23 (56%) Frame = -2 Query: 70 GNLPGKKLVPNSCSPGDPLFXTR 2 G + + NSCSPGDPL R Sbjct: 471 GEIASGQTTSNSCSPGDPLVLER 493 >SB_56887| Best HMM Match : TolA (HMM E-Value=0.66) Length = 404 Score = 27.9 bits (59), Expect = 7.4 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 3/54 (5%) Frame = +1 Query: 37 NSARASSLEDYRIKDEPDPDVRISQDDADKMVEPKNEF---YEDEKDNDKELPP 189 +S+ +SS D+ D D DD D+ + K+E+ +E EKD KE P Sbjct: 230 DSSSSSSSSSSSSSDDDDSDHEKDADDDDEKKD-KDEYKDDFESEKDEGKEKEP 282 >SB_55765| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/20 (60%), Positives = 12/20 (60%) Frame = -2 Query: 61 PGKKLVPNSCSPGDPLFXTR 2 P K NSCSPGDPL R Sbjct: 3 PEKSRRSNSCSPGDPLVLER 22 >SB_53848| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 152 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 K NSCSPGDPL R Sbjct: 26 KFTSNSCSPGDPLVLER 42 >SB_53089| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 ++ NSCSPGDPL R Sbjct: 14 IISNSCSPGDPLVLER 29 >SB_50748| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 ++ NSCSPGDPL R Sbjct: 13 IISNSCSPGDPLVLER 28 >SB_50652| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 +V NSCSPGDPL R Sbjct: 7 VVSNSCSPGDPLVLER 22 >SB_50465| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 179 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 54 LLSNSCSPGDPLVLER 69 >SB_50444| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 Query: 67 NLPGKKLVPNSCSPGDPLFXTR 2 N+ V NSCSPGDPL R Sbjct: 12 NIISIAFVSNSCSPGDPLVLER 33 >SB_49798| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1137 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/42 (26%), Positives = 20/42 (47%) Frame = +1 Query: 55 SLEDYRIKDEPDPDVRISQDDADKMVEPKNEFYEDEKDNDKE 180 + ++YR+ P + + D+AD + NE DE + E Sbjct: 47 AFQNYRVSSSPPSENEVLDDEADSPEQTLNETGTDENETKSE 88 >SB_47807| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 2 LLSNSCSPGDPLVLER 17 >SB_46094| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 186 Score = 27.9 bits (59), Expect = 7.4 Identities = 14/40 (35%), Positives = 19/40 (47%), Gaps = 3/40 (7%) Frame = -2 Query: 112 PD*YERQDRVRP*FGNLPGKKLV---PNSCSPGDPLFXTR 2 P+ D+++ LP + NSCSPGDPL R Sbjct: 37 PETVSNVDKLKETLSKLPNNLFIITTSNSCSPGDPLVLER 76 >SB_46001| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 91 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/20 (65%), Positives = 13/20 (65%) Frame = +3 Query: 15 SGSPGLQEFGTSFFPGRLPN 74 SGSPGLQEF PGR N Sbjct: 15 SGSPGLQEFDDYLEPGRKLN 34 >SB_45805| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 155 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +1 Query: 13 IVDPPGCRNSARASSLEDYRI 75 +VDPPGCRNS + E+++I Sbjct: 15 LVDPPGCRNSIKYGQ-EEFQI 34 >SB_44913| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 6 LLSNSCSPGDPLVLER 21 >SB_39514| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 +V NSCSPGDPL R Sbjct: 19 VVSNSCSPGDPLVLER 34 >SB_39410| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/26 (50%), Positives = 15/26 (57%) Frame = -2 Query: 79 P*FGNLPGKKLVPNSCSPGDPLFXTR 2 P F +L + NSCSPGDPL R Sbjct: 13 PRFSSLHKINNLSNSCSPGDPLVLER 38 >SB_38641| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 ++ NSCSPGDPL R Sbjct: 5 IISNSCSPGDPLVLER 20 >SB_37674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 575 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/33 (36%), Positives = 20/33 (60%) Frame = +1 Query: 76 KDEPDPDVRISQDDADKMVEPKNEFYEDEKDND 174 +DE DP+ RIS +DK + + EF + E + + Sbjct: 362 EDEEDPNQRISIRASDKRIACEEEFSDSEDEGE 394 >SB_37618| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 73 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = +1 Query: 13 IVDPPGCRNSARASSL 60 +VDPPGCRNS S+ Sbjct: 52 LVDPPGCRNSINIESV 67 >SB_35028| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 K + NSCSPGDPL R Sbjct: 8 KVITSNSCSPGDPLVLER 25 >SB_34503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 K V NSCSPGDPL R Sbjct: 3 KAEVSNSCSPGDPLVLER 20 >SB_32635| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 188 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/15 (80%), Positives = 12/15 (80%) Frame = -1 Query: 59 REEARAEFLQPGGST 15 RE R EFLQPGGST Sbjct: 60 RELGRIEFLQPGGST 74 >SB_22981| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 ++ NSCSPGDPL R Sbjct: 1 MISNSCSPGDPLVLER 16 >SB_21474| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/18 (66%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 KK NSCSPGDPL R Sbjct: 4 KKSRSNSCSPGDPLVLER 21 >SB_17198| Best HMM Match : HEAT (HMM E-Value=1.8e-15) Length = 802 Score = 27.9 bits (59), Expect = 7.4 Identities = 17/41 (41%), Positives = 21/41 (51%), Gaps = 4/41 (9%) Frame = -2 Query: 112 PD*YERQDRVRP*----FGNLPGKKLVPNSCSPGDPLFXTR 2 P +ERQ VRP + + + NSCSPGDPL R Sbjct: 64 PGNFERQFPVRPPSPILYCSAECVMTISNSCSPGDPLVLER 104 >SB_16374| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 1 LLSNSCSPGDPLVLER 16 >SB_15205| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 ++ NSCSPGDPL R Sbjct: 4 IISNSCSPGDPLVLER 19 >SB_14826| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 125 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/17 (76%), Positives = 13/17 (76%), Gaps = 1/17 (5%) Frame = -2 Query: 49 LVP-NSCSPGDPLFXTR 2 LVP NSCSPGDPL R Sbjct: 27 LVPSNSCSPGDPLVLER 43 >SB_13552| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/16 (68%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L+ NSCSPGDPL R Sbjct: 7 LLSNSCSPGDPLVLER 22 >SB_9174| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.9 bits (59), Expect = 7.4 Identities = 12/22 (54%), Positives = 13/22 (59%) Frame = -2 Query: 67 NLPGKKLVPNSCSPGDPLFXTR 2 N+ K NSCSPGDPL R Sbjct: 12 NIENKCCRSNSCSPGDPLVLER 33 >SB_7598| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.9 bits (59), Expect = 7.4 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 ++ NSCSPGDPL R Sbjct: 13 IISNSCSPGDPLVLER 28 >SB_2190| Best HMM Match : SGS (HMM E-Value=2.5) Length = 221 Score = 27.9 bits (59), Expect = 7.4 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 + L NSCSPGDPL R Sbjct: 94 RALASNSCSPGDPLVLER 111 >SB_1318| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.9 bits (59), Expect = 7.4 Identities = 13/19 (68%), Positives = 13/19 (68%) Frame = -2 Query: 58 GKKLVPNSCSPGDPLFXTR 2 GKK NSCSPGDPL R Sbjct: 3 GKK-ASNSCSPGDPLVLER 20 >SB_56876| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/23 (56%), Positives = 16/23 (69%), Gaps = 1/23 (4%) Frame = -2 Query: 67 NLPGKKLVP-NSCSPGDPLFXTR 2 N+ +L+P NSCSPGDPL R Sbjct: 18 NVVWLQLLPSNSCSPGDPLVLER 40 >SB_56744| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 30 VSNSCSPGDPLVLER 44 >SB_52638| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 7 VSNSCSPGDPLVLER 21 >SB_49418| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_46691| Best HMM Match : DUF765 (HMM E-Value=9.5) Length = 139 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_40646| Best HMM Match : eIF-5a (HMM E-Value=0.87) Length = 209 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/24 (45%), Positives = 16/24 (66%) Frame = +1 Query: 13 IVDPPGCRNSARASSLEDYRIKDE 84 +VDPPGCRNS + + + I D+ Sbjct: 15 LVDPPGCRNSIKRTQQQLDDIHDK 38 >SB_39503| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 2 VSNSCSPGDPLVLER 16 >SB_36751| Best HMM Match : Exo_endo_phos (HMM E-Value=2e-12) Length = 906 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/37 (35%), Positives = 23/37 (62%) Frame = +1 Query: 130 VEPKNEFYEDEKDNDKELPPEIKDP*QIELPPDPLAI 240 ++P N + EK+ D+E+ E+K P + + P PLA+ Sbjct: 163 IDPPN-LVKLEKEIDEEIEQEVKPPKKEKKPAKPLAV 198 >SB_36172| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 99 Score = 27.5 bits (58), Expect = 9.7 Identities = 9/15 (60%), Positives = 13/15 (86%) Frame = +1 Query: 13 IVDPPGCRNSARASS 57 +VDPPGCRNS + ++ Sbjct: 15 LVDPPGCRNSMKPAA 29 >SB_30594| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 140 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L NSCSPGDPL R Sbjct: 15 LTSNSCSPGDPLVLER 30 >SB_28058| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 K+ NSCSPGDPL R Sbjct: 2 KIRSNSCSPGDPLVLER 18 >SB_25442| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1010 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 +++ NSCSPGDPL R Sbjct: 80 QQMASNSCSPGDPLVLER 97 >SB_22621| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 164 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 40 VSNSCSPGDPLVLER 54 >SB_21689| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 241 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 117 VSNSCSPGDPLVLER 131 >SB_21022| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 308 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 184 VSNSCSPGDPLVLER 198 >SB_19244| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 34 VSNSCSPGDPLVLER 48 >SB_15454| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 K+ NSCSPGDPL R Sbjct: 2 KIGSNSCSPGDPLVLER 18 >SB_15016| Best HMM Match : Peptidase_C9 (HMM E-Value=7.2) Length = 202 Score = 27.5 bits (58), Expect = 9.7 Identities = 14/27 (51%), Positives = 17/27 (62%), Gaps = 1/27 (3%) Frame = +3 Query: 15 SGSPGLQEFGTSFFPG-RLPNQGRTRS 92 SGSPGLQEF ++ G R+ QG S Sbjct: 15 SGSPGLQEFDATWAAGHRMVEQGANSS 41 >SB_13544| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 ++ NSCSPGDPL R Sbjct: 14 VISNSCSPGDPLVLER 29 >SB_9600| Best HMM Match : DUF1596 (HMM E-Value=9.6) Length = 205 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/18 (55%), Positives = 13/18 (72%) Frame = +1 Query: 13 IVDPPGCRNSARASSLED 66 +VDPPGCRNS ++ D Sbjct: 15 LVDPPGCRNSIHEAAALD 32 >SB_8988| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 126 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 3 VSNSCSPGDPLVLER 17 >SB_8663| Best HMM Match : DUF250 (HMM E-Value=9.3e-05) Length = 680 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 214 VSNSCSPGDPLVLER 228 >SB_5162| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 156 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 32 VSNSCSPGDPLVLER 46 >SB_4735| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/22 (54%), Positives = 15/22 (68%) Frame = -2 Query: 67 NLPGKKLVPNSCSPGDPLFXTR 2 +L G ++ NSCSPGDPL R Sbjct: 27 HLFGIGVLSNSCSPGDPLVLER 48 >SB_3677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L NSCSPGDPL R Sbjct: 5 LASNSCSPGDPLVLER 20 >SB_1239| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/17 (64%), Positives = 12/17 (70%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 +L NSCSPGDPL R Sbjct: 2 RLSSNSCSPGDPLVLER 18 >SB_59324| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/21 (61%), Positives = 13/21 (61%) Frame = -2 Query: 64 LPGKKLVPNSCSPGDPLFXTR 2 LP L NSCSPGDPL R Sbjct: 9 LPLPCLRSNSCSPGDPLVLER 29 >SB_57591| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 5 VSNSCSPGDPLVLER 19 >SB_56961| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 3 VSNSCSPGDPLVLER 17 >SB_55315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 7 VSNSCSPGDPLVLER 21 >SB_53934| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 144 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/22 (50%), Positives = 13/22 (59%) Frame = -2 Query: 67 NLPGKKLVPNSCSPGDPLFXTR 2 N+ + NSCSPGDPL R Sbjct: 13 NISCGRFASNSCSPGDPLVLER 34 >SB_53581| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 1584 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/18 (61%), Positives = 11/18 (61%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 K NSCSPGDPL R Sbjct: 1190 KPFASNSCSPGDPLVLER 1207 >SB_52710| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_52100| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 ++ NSCSPGDPL R Sbjct: 24 RITSNSCSPGDPLVLER 40 >SB_51740| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L NSCSPGDPL R Sbjct: 6 LASNSCSPGDPLVLER 21 >SB_49677| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_48720| Best HMM Match : DAGAT (HMM E-Value=1.5e-09) Length = 244 Score = 27.5 bits (58), Expect = 9.7 Identities = 15/52 (28%), Positives = 25/52 (48%) Frame = +1 Query: 25 PGCRNSARASSLEDYRIKDEPDPDVRISQDDADKMVEPKNEFYEDEKDNDKE 180 PG S + Y + D+ D + DD+D N+FY+D+ D+D + Sbjct: 136 PGITTHMAVHSYDYYDVDDDNDDN---DNDDSDV---DDNDFYDDDNDDDDD 181 >SB_48356| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 235 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/23 (56%), Positives = 14/23 (60%), Gaps = 1/23 (4%) Frame = -2 Query: 67 NLPGKKLVP-NSCSPGDPLFXTR 2 N+P P NSCSPGDPL R Sbjct: 103 NIPDHYSSPSNSCSPGDPLVLER 125 >SB_47445| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 135 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 11 VSNSCSPGDPLVLER 25 >SB_46997| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/13 (84%), Positives = 12/13 (92%) Frame = -1 Query: 53 EARAEFLQPGGST 15 E+R EFLQPGGST Sbjct: 8 ESRIEFLQPGGST 20 >SB_46149| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 149 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 25 VSNSCSPGDPLVLER 39 >SB_45377| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L NSCSPGDPL R Sbjct: 17 LASNSCSPGDPLVLER 32 >SB_45308| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 131 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/21 (57%), Positives = 13/21 (61%) Frame = -2 Query: 64 LPGKKLVPNSCSPGDPLFXTR 2 + KK NSCSPGDPL R Sbjct: 1 MSSKKGGSNSCSPGDPLVLER 21 >SB_44379| Best HMM Match : Peptidase_M28 (HMM E-Value=6.6e-11) Length = 1098 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 K + NSCSPGDPL R Sbjct: 971 KGWISNSCSPGDPLVLER 988 >SB_44084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 159 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/18 (55%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 + + NSCSPGDPL R Sbjct: 32 RSITSNSCSPGDPLVLER 49 >SB_43512| Best HMM Match : RNA_pol_delta (HMM E-Value=4.7) Length = 241 Score = 27.5 bits (58), Expect = 9.7 Identities = 18/52 (34%), Positives = 25/52 (48%) Frame = +1 Query: 19 DPPGCRNSARASSLEDYRIKDEPDPDVRISQDDADKMVEPKNEFYEDEKDND 174 D P S S L D ++DE D S DD D + +E +DE+D+D Sbjct: 73 DTPALETSGE-SKLPDTPVEDEESEDDDDSFDDGDDEEDEDDE--DDEEDSD 121 >SB_43133| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_42589| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 183 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 59 VSNSCSPGDPLVLER 73 >SB_38659| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_38562| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 195 Score = 27.5 bits (58), Expect = 9.7 Identities = 12/28 (42%), Positives = 16/28 (57%) Frame = +1 Query: 13 IVDPPGCRNSARASSLEDYRIKDEPDPD 96 +VDPPGCRNS +D D+ P+ Sbjct: 15 LVDPPGCRNSIINRFSKDIGFMDDLLPE 42 >SB_38151| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 165 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 41 VSNSCSPGDPLVLER 55 >SB_37939| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_36967| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 128 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 4 VSNSCSPGDPLVLER 18 >SB_35822| Best HMM Match : DUF765 (HMM E-Value=3.3) Length = 138 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 14 VSNSCSPGDPLVLER 28 >SB_33697| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 130 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 ++ NSCSPGDPL R Sbjct: 5 VISNSCSPGDPLVLER 20 >SB_32912| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 446 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/23 (47%), Positives = 14/23 (60%) Frame = -2 Query: 70 GNLPGKKLVPNSCSPGDPLFXTR 2 G+ ++ NSCSPGDPL R Sbjct: 314 GSYGANRVRSNSCSPGDPLVLER 336 >SB_32645| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 139 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 15 VSNSCSPGDPLVLER 29 >SB_32565| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 162 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L NSCSPGDPL R Sbjct: 37 LTSNSCSPGDPLVLER 52 >SB_30829| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 18 VSNSCSPGDPLVLER 32 >SB_29496| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/17 (64%), Positives = 11/17 (64%) Frame = -2 Query: 52 KLVPNSCSPGDPLFXTR 2 K NSCSPGDPL R Sbjct: 1 KTTSNSCSPGDPLVLER 17 >SB_28515| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 154 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 30 VSNSCSPGDPLVLER 44 >SB_26199| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 148 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/18 (61%), Positives = 12/18 (66%) Frame = -2 Query: 55 KKLVPNSCSPGDPLFXTR 2 K + NSCSPGDPL R Sbjct: 21 KTISSNSCSPGDPLVLER 38 >SB_23700| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_22083| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 143 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/26 (50%), Positives = 14/26 (53%) Frame = -2 Query: 79 P*FGNLPGKKLVPNSCSPGDPLFXTR 2 P G K + NSCSPGDPL R Sbjct: 8 PVIGGNEWKLELSNSCSPGDPLVLER 33 >SB_21779| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 17 VSNSCSPGDPLVLER 31 >SB_21702| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 138 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 14 VSNSCSPGDPLVLER 28 >SB_21233| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 158 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 34 VSNSCSPGDPLVLER 48 >SB_19926| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 213 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L NSCSPGDPL R Sbjct: 88 LTSNSCSPGDPLVLER 103 >SB_19315| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L NSCSPGDPL R Sbjct: 11 LASNSCSPGDPLVLER 26 >SB_19181| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 ++ NSCSPGDPL R Sbjct: 17 VISNSCSPGDPLVLER 32 >SB_16515| Best HMM Match : Extensin_2 (HMM E-Value=0.12) Length = 917 Score = 27.5 bits (58), Expect = 9.7 Identities = 13/44 (29%), Positives = 22/44 (50%) Frame = +1 Query: 91 PDVRISQDDADKMVEPKNEFYEDEKDNDKELPPEIKDP*QIELP 222 PD+R + D + E ++ Y DE + + PP + P + LP Sbjct: 496 PDIREEEMDEQEPQEYRSSSYVDENADTRSNPPMYRGPPEGPLP 539 >SB_16330| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 8 VSNSCSPGDPLVLER 22 >SB_14766| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 134 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 10 VSNSCSPGDPLVLER 24 >SB_14383| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 147 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 23 VSNSCSPGDPLVLER 37 >SB_14039| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 142 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 18 VSNSCSPGDPLVLER 32 >SB_13084| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L NSCSPGDPL R Sbjct: 11 LASNSCSPGDPLVLER 26 >SB_12674| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 127 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L NSCSPGDPL R Sbjct: 3 LASNSCSPGDPLVLER 18 >SB_9111| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 151 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 27 VSNSCSPGDPLVLER 41 >SB_9069| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 132 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L NSCSPGDPL R Sbjct: 7 LASNSCSPGDPLVLER 22 >SB_8550| Best HMM Match : MASE1 (HMM E-Value=1.5) Length = 317 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 193 VSNSCSPGDPLVLER 207 >SB_6839| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 133 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 9 VSNSCSPGDPLVLER 23 >SB_6726| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 141 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/15 (73%), Positives = 11/15 (73%) Frame = -2 Query: 46 VPNSCSPGDPLFXTR 2 V NSCSPGDPL R Sbjct: 17 VSNSCSPGDPLVLER 31 >SB_5582| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 150 Score = 27.5 bits (58), Expect = 9.7 Identities = 10/16 (62%), Positives = 12/16 (75%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 ++ NSCSPGDPL R Sbjct: 25 VISNSCSPGDPLVLER 40 >SB_5286| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 136 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L NSCSPGDPL R Sbjct: 11 LTSNSCSPGDPLVLER 26 >SB_1535| Best HMM Match : No HMM Matches (HMM E-Value=.) Length = 129 Score = 27.5 bits (58), Expect = 9.7 Identities = 11/16 (68%), Positives = 11/16 (68%) Frame = -2 Query: 49 LVPNSCSPGDPLFXTR 2 L NSCSPGDPL R Sbjct: 4 LASNSCSPGDPLVLER 19 Database: nematostella Posted date: Oct 22, 2007 1:22 PM Number of letters in database: 16,821,457 Number of sequences in database: 59,808 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 17,642,690 Number of Sequences: 59808 Number of extensions: 322282 Number of successful extensions: 2722 Number of sequences better than 10.0: 253 Number of HSP's better than 10.0 without gapping: 2471 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 2692 length of database: 16,821,457 effective HSP length: 79 effective length of database: 12,096,625 effective search space used: 1608851125 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -