BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00196 (684 letters) Database: bee 438 sequences; 146,343 total letters Searching......................................................done Score E Sequences producing significant alignments: (bits) Value AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter... 25 0.51 AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter... 25 0.89 AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding pr... 23 2.1 DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channe... 21 8.3 DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride c... 21 8.3 >AY395072-1|AAQ96728.1| 593|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 593 Score = 25.4 bits (53), Expect = 0.51 Identities = 11/21 (52%), Positives = 16/21 (76%) Frame = +3 Query: 261 AEWSRELARVEDEIATLRTVL 323 +E R+L R+ED++ATLR L Sbjct: 559 SEKFRKLIRIEDDVATLRMKL 579 >AY395071-1|AAQ96727.1| 646|Apis mellifera GABA neurotransmitter transporter-1B protein. Length = 646 Score = 24.6 bits (51), Expect = 0.89 Identities = 11/21 (52%), Positives = 15/21 (71%) Frame = +3 Query: 261 AEWSRELARVEDEIATLRTVL 323 +E R+L R+ED +ATLR L Sbjct: 612 SEKFRKLIRIEDNVATLRMKL 632 >AB083010-1|BAC54131.1| 132|Apis mellifera fatty acid binding protein protein. Length = 132 Score = 23.4 bits (48), Expect = 2.1 Identities = 13/50 (26%), Positives = 22/50 (44%) Frame = +3 Query: 351 LKRKLGITVWKEITEDVNQGLKNVKESQVYQKTESVIKTTAEKTSSIIGG 500 + RK+G +V + N GL +K + ++ TE K E + G Sbjct: 29 MTRKVGSSVSPVVELTENNGLYTLKTTSPFKNTEIKFKLGEEFEEETVDG 78 >DQ667184-1|ABG75736.1| 489|Apis mellifera GABA-gated ion channel protein. Length = 489 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/27 (33%), Positives = 14/27 (51%) Frame = -3 Query: 664 ATGVTQRLVEALSRVRSRSYFTLDVFI 584 ATG+ QRL + R+ YF ++ Sbjct: 224 ATGIYQRLSLSFKLQRNIGYFVFQTYL 250 >DQ667181-1|ABG75733.1| 445|Apis mellifera GABA-gated chloride channel protein. Length = 445 Score = 21.4 bits (43), Expect = 8.3 Identities = 9/27 (33%), Positives = 15/27 (55%) Frame = -3 Query: 664 ATGVTQRLVEALSRVRSRSYFTLDVFI 584 +TG RL + VRS Y+ + ++I Sbjct: 203 STGNYSRLACEIQFVRSMGYYLIQIYI 229 Database: bee Posted date: Oct 23, 2007 1:17 PM Number of letters in database: 146,343 Number of sequences in database: 438 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 170,375 Number of Sequences: 438 Number of extensions: 3080 Number of successful extensions: 6 Number of sequences better than 10.0: 5 Number of HSP's better than 10.0 without gapping: 6 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 6 length of database: 146,343 effective HSP length: 56 effective length of database: 121,815 effective search space used: 20830365 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -