BLASTX 2.2.12 [Aug-07-2005] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= wdS00195 (584 letters) Database: rice 37,544 sequences; 14,793,348 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value 01_01_1188 - 9446764-9446943,9447030-9447232,9447307-9447438,944... 30 1.2 06_03_1273 + 28892774-28893946,28894964-28895104,28895277-288953... 28 4.8 01_06_1625 + 38729803-38731115,38731202-38731391,38731472-387315... 28 4.8 01_06_0381 + 28878811-28879120,28880189-28880331,28880753-288815... 28 4.8 02_02_0220 - 7992124-7992351,7992458-7992562,7993499-7993711,799... 28 6.3 01_01_0069 + 536787-537068,537193-537493,537528-537581,538848-53... 27 8.3 >01_01_1188 - 9446764-9446943,9447030-9447232,9447307-9447438, 9447570-9447657,9447723-9447950,9449542-9449763 Length = 350 Score = 30.3 bits (65), Expect = 1.2 Identities = 12/38 (31%), Positives = 22/38 (57%) Frame = +2 Query: 59 FSDVRADYNRKRSQAKLKVDVLVSRQVRLIVRPAIRRR 172 + +VR D+ +S KLK ++ + R V + PA+ +R Sbjct: 85 YEEVRCDFKATQSTLKLKAELRILRDVAEVYTPAVYKR 122 >06_03_1273 + 28892774-28893946,28894964-28895104,28895277-28895329, 28895852-28895966 Length = 493 Score = 28.3 bits (60), Expect = 4.8 Identities = 15/35 (42%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +1 Query: 91 KVPSEVES*CFSQSP-SSINRAARDQAPAPGCENA 192 + P+ ++S C S +P SS+ R RD AP+PG +A Sbjct: 138 RCPAPIKS-CSSPAPVSSVFREFRDAAPSPGTPDA 171 >01_06_1625 + 38729803-38731115,38731202-38731391,38731472-38731504, 38731582-38732199,38732304-38733011 Length = 953 Score = 28.3 bits (60), Expect = 4.8 Identities = 13/43 (30%), Positives = 21/43 (48%) Frame = -3 Query: 144 NRTWRLTKTSTFNFAWDLFRL*SARTSEKGLKCRRERAAVCQA 16 N R +K +NF + F L + S + +C R+ VC+A Sbjct: 640 NMGLRASKEKKYNFGAEFFELAAEFFSSRNAECDENRSKVCKA 682 >01_06_0381 + 28878811-28879120,28880189-28880331,28880753-28881532, 28882568-28883968 Length = 877 Score = 28.3 bits (60), Expect = 4.8 Identities = 14/51 (27%), Positives = 26/51 (50%) Frame = -1 Query: 506 QKKTSKSNKMARYYSEHAFLTSWTDYRNDASLAHTKKKLEHKTRNYTVDTQ 354 +KK + Y SE ++ S +R++ S AHT +HK + ++ D + Sbjct: 718 RKKHHPESDEENYDSEESYKHSRKKHRSEDSRAHTSDVHKHKLKRHSKDLE 768 >02_02_0220 - 7992124-7992351,7992458-7992562,7993499-7993711, 7993937-7994196,7994425-7994701,7995226-7995371, 7995519-7995903,7996680-7996964 Length = 632 Score = 27.9 bits (59), Expect = 6.3 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 1/22 (4%) Frame = -1 Query: 443 SWTDYRNDAS-LAHTKKKLEHK 381 SWTDY+ND+S L + K KL+ K Sbjct: 432 SWTDYKNDSSQLDNLKGKLKGK 453 >01_01_0069 + 536787-537068,537193-537493,537528-537581,538848-539241, 539345-539595,539678-539798,539893-540133,540341-540445, 540571-540615,540738-540890,541132-541410,541705-541841, 541975-542017,542228-542329 Length = 835 Score = 27.5 bits (58), Expect = 8.3 Identities = 11/29 (37%), Positives = 18/29 (62%) Frame = +2 Query: 224 SLNYFIRDSLVGQEPSRSDSGAGLTYLVL 310 +L +RD LV Q ++ DS AG+T+ + Sbjct: 286 ALTDLLRDDLVSQPKNKCDSDAGITFTTI 314 Database: rice Posted date: Oct 4, 2007 10:57 AM Number of letters in database: 14,793,348 Number of sequences in database: 37,544 Lambda K H 0.318 0.134 0.401 Gapped Lambda K H 0.279 0.0580 0.190 Matrix: BLOSUM62 Gap Penalties: Existence: 9, Extension: 2 Number of Hits to DB: 14,061,094 Number of Sequences: 37544 Number of extensions: 274199 Number of successful extensions: 501 Number of sequences better than 10.0: 6 Number of HSP's better than 10.0 without gapping: 497 Number of HSP's successfully gapped in prelim test: 0 Number of HSP's that attempted gapping in prelim test: 0 Number of HSP's gapped (non-prelim): 501 length of database: 14,793,348 effective HSP length: 78 effective length of database: 11,864,916 effective search space used: 1376330256 frameshift window, decay const: 40, 0.1 T: 12 A: 40 X1: 16 ( 7.3 bits) X2: 37 (14.9 bits) X3: 62 (25.0 bits) S1: 41 (21.7 bits)
- SilkBase 1999-2023 -